KEGG   Ornithorhynchus anatinus (platypus): 100087304Help
Entry
100087304         CDS       T01045                                 

Gene name
CACNG8
Definition
calcium channel, voltage-dependent, gamma subunit 8
Orthology
K04873  
voltage-dependent calcium channel gamma-8
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
MAPK signaling pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
Oxytocin signaling pathway
Hypertrophic cardiomyopathy (HCM)
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100087304 (CACNG8)
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    100087304 (CACNG8)
  Circulatory system
   04260 Cardiac muscle contraction
    100087304 (CACNG8)
   04261 Adrenergic signaling in cardiomyocytes
    100087304 (CACNG8)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    100087304 (CACNG8)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    100087304 (CACNG8)
   05414 Dilated cardiomyopathy (DCM)
    100087304 (CACNG8)
Ion channels [BR:oaa04040]
 Voltage-gated cation channels
  Ca2+ channel, CACN gamma
   100087304 (CACNG8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 312 aa AA seqDB search
PPAAGTAPPLPRWWPPAPRLPGPGKLESLKRWQEERVAWCERGVQVLLTTVGAFAAFGLM
TIAISTDYWLYTRAFICNTTNLTGPGGGEEASSPHRDKKDPGGLTHSGLWRICCLEGLKR
GICVKINHFPEDTDYDHDSAEYLLRVVRASSIFPILSAILLLLGGVCVAASRVYKSKRNI
ILGAGILFVAAGESFGGERESITLSLSKKSISTGGAGAGGPSAILRLPSYRFRYRRRSRS
SSRSTEPSQSRDTSPVGGKGFSSMDISIYTLSRDPSKGSVGGGAGAGGRAGTGGAGAGGA
GTGGAGTGGAGT
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
ccaccggccgccggcacggccccccccctcccccggtggtggccgccggccccccggctg
cccgggcccggcaagctggagtcgctgaagcggtggcaagaggaacgggtggcctggtgt
gagcggggcgttcaggtgctgctgaccacagtgggggccttcgccgcctttggcctaatg
accatcgccatcagcaccgactactggctctacacgcgtgccttcatctgtaacaccacc
aacctgaccgggcccggcggaggcgaggaggcctcctccccacacagggataagaaggat
cccggtggcctcacccactcagggctctggaggatctgctgcctggaaggactgaagaga
ggtatctgtgtgaaaatcaatcactttcctgaggacacagactacgaccatgacagtgca
gagtatctgctacgtgtggtccgagcctccagcatcttcccgatcctcagcgccatcctg
ctgttgctcggaggcgtgtgtgtggcggcctcccgggtctacaagtccaagaggaacatc
atccttggggccgggatcctcttcgtggctgcaggtgagagcttcgggggagagagagag
agtattacgctgtccctgtccaaaaagagtatatctaccgggggagccggggccgggggg
ccctcggccatcctgcgcctccccagctaccggttccgttaccgccgccgctcgcggtcc
agctcccgctccaccgagccttcgcagtcccgggacacgtcccccgtgggcggcaagggc
ttctcgtccatggacatctccatctacacgctgtcccgggacccgtccaagggcagcgtg
ggcggtggcgcgggggccggcggccgggcgggcaccggcggggcgggcgccgggggggcg
ggcaccgggggggcgggcaccgggggggcgggcacg

DBGET integrated database retrieval system