KEGG   Ornithorhynchus anatinus (platypus): 100087369Help
Entry
100087369         CDS       T01045                                 

Gene name
APOA4
Definition
apolipoprotein A-IV
Orthology
K08760  
apolipoprotein A-IV
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Fat digestion and absorption
Vitamin digestion and absorption
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Organismal Systems
  Digestive system
   04975 Fat digestion and absorption
    100087369 (APOA4)
   04977 Vitamin digestion and absorption
    100087369 (APOA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 372 aa AA seqDB search
MLLHYSMYFYWIRGVQAEAPSSDEVATELWKYLSLLETLPRDIAEEPQFSELSKKLETLL
RDKIKEAGALQKKLEPLASELQSQLSQVDSDQLKEQVLRELSSLQAYSDKFHQQIGRSVQ
DLQEKLGPYASELQSQVRQNAPLLAQQLEEQLRENVDTLRVSLTPMADELRTTITQNVDQ
MKDRLAPYTDRLGQDVAKLQRDLAPYADRLGQDVAKLQRDLAPYACEAQEKLGQQWGELS
SQIKQNADELRVRLGPYAEEMQARLAPYADEMREKLEGNAAELRQSLGKLSGHMDRHVED
FHRNMGPFGETLNQAVVKQMAGLREALEPYTGEMDGRLSVLEKGFRDQFDTILSSARKQA
QSQGSWFTEGEE
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgctgcttcactacagcatgtacttctactggattaggggggtccaggctgaggcacct
tcatcagatgaagtagccaccgagttgtggaagtatctcagcctgctggaaacactgccc
cgggacatcgctgaggagccgcagttttcagagctcagcaagaagctagaaactctcttg
cgggacaaaataaaggaagctggagccctgcagaagaagctggagcccctggcctcggaa
ctacaatcccagctgagccaggtggactcagaccagctgaaggagcaggtcctccgggag
ctgagctcgctgcaggcctactccgacaagttccaccagcagatcggccgcagtgtacaa
gacctgcaggagaagctggggccctacgcctctgagctccagtcccaggtcaggcagaac
gccccactgcttgcgcagcagctggaggagcagctgagagagaacgtggacacactgcgg
gtctccctgactccgatggccgacgaactgcgcaccaccatcacccagaacgtggaccag
atgaaggaccgcctggccccctacactgaccgcctcggccaggacgtggccaaactgcaa
cgggacctggccccctacgctgaccgcctcgggcaggacgtggccaagctgcaacgagac
ctggccccctatgcctgtgaagcgcaggagaagttgggccagcagtggggcgagctgtcc
tcccagataaagcagaatgctgacgagctgcgggtccggctgggcccctatgcggaggag
atgcaggcccgcttggccccctatgcggacgagatgcgggagaagctggaaggcaacgct
gccgagctgcggcagtccctgggcaagctgagcggccacatggaccggcacgttgaggat
ttccacaggaacatggggccattcggggagaccctaaaccaggcggtggtgaagcagatg
gcggggctgcgcgaggcactggagccctacactggagaaatggacgggcgcctcagcgtc
ctggaaaagggtttccgagaccagtttgacaccatcctttcctctgccaggaagcaggcc
cagagccagggatcctggttcaccgaaggcgaggagtga

DBGET integrated database retrieval system