KEGG   Ornithorhynchus anatinus (platypus): 100087369Help
Entry
100087369         CDS       T01045                                 

Gene name
APOA4
Definition
(RefSeq) apolipoprotein A4
  KO
K08760  
apolipoprotein A-IV
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Fat digestion and absorption
Vitamin digestion and absorption
Cholesterol metabolism
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Organismal Systems
  Digestive system
   04975 Fat digestion and absorption
    100087369 (APOA4)
   04979 Cholesterol metabolism
    100087369 (APOA4)
   04977 Vitamin digestion and absorption
    100087369 (APOA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Un
AA seq 372 aa AA seqDB search
MLLHYSMYFYWIRGVQAEAPSSDEVATELWKYLSLLETLPRDIAEEPQFSELSKKLETLL
RDKIKEAGALQKKLEPLASELQSQLSQVDSDQLKEQVLRELSSLQAYSDKFHQQIGRSVQ
DLQEKLGPYASELQSQVRQNAPLLAQQLEEQLRENVDTLRVSLTPMADELRTTITQNVDQ
MKDRLAPYTDRLGQDVAKLQRDLAPYADRLGQDVAKLQRDLAPYACEAQEKLGQQWGELS
SQIKQNADELRVRLGPYAEEMQARLAPYADEMREKLEGNAAELRQSLGKLSGHMDRHVED
FHRNMGPFGETLNQAVVKQMAGLREALEPYTGEMDGRLSVLEKGFRDQFDTILSSARKQA
QSQGSWFTEGEE
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgctgcttcactacagcatgtacttctactggattaggggggtccaggctgaggcacct
tcatcagatgaagtagccaccgagttgtggaagtatctcagcctgctggaaacactgccc
cgggacatcgctgaggagccgcagttttcagagctcagcaagaagctagaaactctcttg
cgggacaaaataaaggaagctggagccctgcagaagaagctggagcccctggcctcggaa
ctacaatcccagctgagccaggtggactcagaccagctgaaggagcaggtcctccgggag
ctgagctcgctgcaggcctactccgacaagttccaccagcagatcggccgcagtgtacaa
gacctgcaggagaagctggggccctacgcctctgagctccagtcccaggtcaggcagaac
gccccactgcttgcgcagcagctggaggagcagctgagagagaacgtggacacactgcgg
gtctccctgactccgatggccgacgaactgcgcaccaccatcacccagaacgtggaccag
atgaaggaccgcctggccccctacactgaccgcctcggccaggacgtggccaaactgcaa
cgggacctggccccctacgctgaccgcctcgggcaggacgtggccaagctgcaacgagac
ctggccccctatgcctgtgaagcgcaggagaagttgggccagcagtggggcgagctgtcc
tcccagataaagcagaatgctgacgagctgcgggtccggctgggcccctatgcggaggag
atgcaggcccgcttggccccctatgcggacgagatgcgggagaagctggaaggcaacgct
gccgagctgcggcagtccctgggcaagctgagcggccacatggaccggcacgttgaggat
ttccacaggaacatggggccattcggggagaccctaaaccaggcggtggtgaagcagatg
gcggggctgcgcgaggcactggagccctacactggagaaatggacgggcgcctcagcgtc
ctggaaaagggtttccgagaccagtttgacaccatcctttcctctgccaggaagcaggcc
cagagccagggatcctggttcaccgaaggcgaggagtga

DBGET integrated database retrieval system