KEGG   Ornithorhynchus anatinus (platypus): 100087706Help
Entry
100087706         CDS       T01045                                 

Definition
protein disulfide-isomerase A5-like
Orthology
K09583  
protein disulfide isomerase family A, member 5 [EC:5.3.4.1]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 193 aa AA seqDB search
CGHCKKMKPEFEKAAEELHAQGEGPGVLAAVDATVNKAVAERFRVSGFPTVKYFENGEER
FTLPHLRTKKKIVDWLRKYATRGLRVDGHPWPSIHSLNWCPHCKSAIPHFTAAADLFKDD
RKIAYAAVDCAKEQNRDLCKQEGVDGYPTFNYYNYGKFAEKYNGERVESDFAAFIRSLRE
RDHEKLGKKRDEL
NT seq 584 nt NT seq  +upstreamnt  +downstreamnt
ggtgcgggcactgcaagaagatgaagccggagtttgagaaagcagcggaagagcttcatg
cccagggggagggcccaggtgtcctggcggccgtcgatgccaccgtcaacaaggccgtgg
ccgagcgtttccgcgtgtccggcttccccacggtgaagtactttgagaacggcgaagagc
ggttcacactgccacacctgcgcaccaagaagaagatcgtggactggctgcgcaagtacg
ctacaaggggcctgcgggtcgatgggcatccctggccatccattcattcactcaattggt
gccctcactgcaagagcgccatccctcacttcaccgccgccgctgacctcttcaaggacg
atcggaagatcgcctacgccgcggtcgactgtgccaaagagcagaaccgggatctgtgca
agcaggagggggtggatggctaccccaccttcaactactacaactatgggaagtttgctg
agaaatacaatggagagcgggtggagtccgactttgctgcttttattcgctccctgcggg
agcgggaccacgaaaaactggggaagaagagagatgagctgtag

DBGET integrated database retrieval system