KEGG   Ornithorhynchus anatinus (platypus): 100087706Help
Entry
100087706         CDS       T01045                                 

Gene name
PDIA5
Definition
(RefSeq) protein disulfide isomerase family A member 5
  KO
K09583  
protein disulfide isomerase family A, member 5 [EC:5.3.4.1]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Brite
Enzymes [BR:oaa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100087706 (PDIA5)
Chaperones and folding catalysts [BR:oaa03110]
 Protein folding catalysts
  Protein disulfide isomerase
   100087706 (PDIA5)
Membrane trafficking [BR:oaa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    100087706 (PDIA5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 178 aa AA seqDB search
CAFPSAGCGHCKKMKPEFEKAAEELHAQGEGPGVLAAVDATVNKAVAERFRVSGFPTVKY
FENGEERFTLPHLRTKKKIVDWLRCPHCKSAIPHFTAAADLFKDDRKIAYAAVDCAKEQN
RDLCKQEGVDGYPTFNYYNYGKFAEKYNGERVESDFAAFIRSLRERDHEKLGKKRDEL
NT seq 539 nt NT seq  +upstreamnt  +downstreamnt
cctgtgctttcccttctgcagggtgcgggcactgcaagaagatgaagccggagtttgaga
aagcagcggaagagcttcatgcccagggggagggcccaggtgtcctggcggccgtcgatg
ccaccgtcaacaaggccgtggccgagcgtttccgcgtgtccggcttccccacggtgaagt
actttgagaacggcgaagagcggttcacactgccacacctgcgcaccaagaagaagatcg
tggactggctgcggtgccctcactgcaagagcgccatccctcacttcaccgccgccgctg
acctcttcaaggacgatcggaagatcgcctacgccgcggtcgactgtgccaaagagcaga
accgggatctgtgcaagcaggagggggtggatggctaccccaccttcaactactacaact
atgggaagtttgctgagaaatacaatggagagcgggtggagtccgactttgctgctttta
ttcgctccctgcgggagcgggaccacgaaaaactggggaagaagagagatgagctgtag

DBGET integrated database retrieval system