KEGG   Ornithorhynchus anatinus (platypus): 100087731Help
Entry
100087731         CDS       T01045                                 

Definition
choline/ethanolamine kinase-like
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylcholine (PC) biosynthesis, choline => PC
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100087731
Enzymes [BR:oaa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     100087731
    2.7.1.82  ethanolamine kinase
     100087731
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 142 aa AA seqDB search
PVAVVEPGAKVAAAAAAGPDGGQEGRRRASSKSREAELRAFRWCREFLGGAWRRVRPEEL
GVSPVSGGLSNLLFRCSLPEHIPSVGDEPRQVLLRVYGAILQGVDSLVLESVMFAILAER
ELGPRLYGVFPEGRLEQYIRIH
NT seq 428 nt NT seq  +upstreamnt  +downstreamnt
ggccagtagcggtagttgagccaggggccaaggtggcggcggcggcggcggccggtcccg
acggcggccaagaggggcggcgccgagcttcgtccaaaagccgagaggccgagctccggg
ccttccgctggtgccgggagttcctggggggggcctggcggcgagtgcggcccgaggagc
tgggcgtcagccccgtcagcggtggcctcagtaacctgctgttccgctgctccctccccg
agcacatccccagcgtcggggatgaaccgcgccaggtgctgctcagggtctacggggcca
ttctgcagggtgtggattccctggtcctggaaagcgtgatgttcgccatcctggcagaac
gggagctgggcccgcggttgtacggcgtgttccccgagggtcggctggagcagtacatcc
gaatccac

DBGET integrated database retrieval system