KEGG   Ornithorhynchus anatinus (platypus): 100087731Help
Entry
100087731         CDS       T01045                                 

Gene name
CHKB
Definition
(RefSeq) choline kinase beta
  KO
K14156  choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa00564  Glycerophospholipid metabolism
oaa01100  Metabolic pathways
oaa05231  Choline metabolism in cancer
Module
oaa_M00090  Phosphatidylcholine (PC) biosynthesis, choline => PC
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100087731 (CHKB)
 Human Diseases
  Cancers
   05231 Choline metabolism in cancer
    100087731 (CHKB)
Enzymes [BR:oaa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     100087731 (CHKB)
    2.7.1.82  ethanolamine kinase
     100087731 (CHKB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Choline_kinase
Motif
Other DBs
NCBI-GeneID: 100087731
NCBI-ProteinID: XP_001517593
Position
Un
AA seq 142 aa AA seqDB search
PVAVVEPGAKVAAAAAAGPDGGQEGRRRASSKSREAELRAFRWCREFLGGAWRRVRPEEL
GVSPVSGGLSNLLFRCSLPEHIPSVGDEPRQVLLRVYGAILQGVDSLVLESVMFAILAER
ELGPRLYGVFPEGRLEQYIRIH
NT seq 428 nt NT seq  +upstreamnt  +downstreamnt
ggccagtagcggtagttgagccaggggccaaggtggcggcggcggcggcggccggtcccg
acggcggccaagaggggcggcgccgagcttcgtccaaaagccgagaggccgagctccggg
ccttccgctggtgccgggagttcctggggggggcctggcggcgagtgcggcccgaggagc
tgggcgtcagccccgtcagcggtggcctcagtaacctgctgttccgctgctccctccccg
agcacatccccagcgtcggggatgaaccgcgccaggtgctgctcagggtctacggggcca
ttctgcagggtgtggattccctggtcctggaaagcgtgatgttcgccatcctggcagaac
gggagctgggcccgcggttgtacggcgtgttccccgagggtcggctggagcagtacatcc
gaatccac

DBGET integrated database retrieval system