KEGG   Ornithorhynchus anatinus (platypus): 100087807Help
Entry
100087807         CDS       T01045                                 

Definition
profilin-3-like
Orthology
K05759  
profilin
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Rap1 signaling pathway
Regulation of actin cytoskeleton
Salmonella infection
Class
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:oaa04015]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:oaa04810]
Human Diseases; Infectious diseases; Salmonella infection [PATH:oaa05132]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 137 aa AA seqDB search
MRDWRILVEAVLRPGRVEDVAVVGHSANRCVWASRPGGLLAAISPQEVGVLTGPDRRSFL
LAGFRLAGRRCYVIRDHLLLDGDGVLDGRTAGPEGRAVCVGRTPKVLVVLLGRRGVHGGL
LNKTAHSLIRLLKSQGT
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgactggcggatcctggtggaggccgtgctgcggcccgggcgcgtcgaggacgtg
gccgtggtggggcactccgccaaccgctgcgtctgggcctcccggcccggggggctgctg
gccgccatctccccgcaggaggtgggcgtgctgaccgggccggaccgccggtccttcctg
ctggcgggcttccgcctggccggccgccgctgctatgtcatccgagaccacctgctgctg
gacggcgacggggtcctggacggccggacggcggggccggaggggcgggccgtgtgcgtg
ggccgcacccccaaggtcctggtcgtgctgctgggccggaggggcgtccacggcgggttg
ctcaacaagaccgcccacagcctcatccggctcctcaaatcccaaggcacctag

DBGET integrated database retrieval system