KEGG   Ornithorhynchus anatinus (platypus): 100087942Help
Entry
100087942         CDS       T01045                                 

Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 2
  KO
K04369  mitogen-activated protein kinase kinase 2 [EC:2.7.12.2]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa01521  EGFR tyrosine kinase inhibitor resistance
oaa01522  Endocrine resistance
oaa04010  MAPK signaling pathway
oaa04012  ErbB signaling pathway
oaa04014  Ras signaling pathway
oaa04015  Rap1 signaling pathway
oaa04022  cGMP-PKG signaling pathway
oaa04024  cAMP signaling pathway
oaa04066  HIF-1 signaling pathway
oaa04068  FoxO signaling pathway
oaa04071  Sphingolipid signaling pathway
oaa04072  Phospholipase D signaling pathway
oaa04140  Autophagy - animal
oaa04150  mTOR signaling pathway
oaa04151  PI3K-Akt signaling pathway
oaa04210  Apoptosis
oaa04218  Cellular senescence
oaa04270  Vascular smooth muscle contraction
oaa04370  VEGF signaling pathway
oaa04371  Apelin signaling pathway
oaa04540  Gap junction
oaa04550  Signaling pathways regulating pluripotency of stem cells
oaa04620  Toll-like receptor signaling pathway
oaa04650  Natural killer cell mediated cytotoxicity
oaa04660  T cell receptor signaling pathway
oaa04662  B cell receptor signaling pathway
oaa04664  Fc epsilon RI signaling pathway
oaa04720  Long-term potentiation
oaa04722  Neurotrophin signaling pathway
oaa04730  Long-term depression
oaa04810  Regulation of actin cytoskeleton
oaa04910  Insulin signaling pathway
oaa04912  GnRH signaling pathway
oaa04915  Estrogen signaling pathway
oaa04916  Melanogenesis
oaa04917  Prolactin signaling pathway
oaa04919  Thyroid hormone signaling pathway
oaa04921  Oxytocin signaling pathway
oaa04926  Relaxin signaling pathway
oaa04934  Cushing's syndrome
oaa05020  Prion diseases
oaa05161  Hepatitis B
oaa05164  Influenza A
oaa05165  Human papillomavirus infection
oaa05167  Kaposi's sarcoma-associated herpesvirus infection
oaa05200  Pathways in cancer
oaa05205  Proteoglycans in cancer
oaa05206  MicroRNAs in cancer
oaa05210  Colorectal cancer
oaa05211  Renal cell carcinoma
oaa05213  Endometrial cancer
oaa05214  Glioma
oaa05215  Prostate cancer
oaa05216  Thyroid cancer
oaa05218  Melanoma
oaa05219  Bladder cancer
oaa05220  Chronic myeloid leukemia
oaa05221  Acute myeloid leukemia
oaa05223  Non-small cell lung cancer
oaa05224  Breast cancer
oaa05225  Hepatocellular carcinoma
oaa05226  Gastric cancer
oaa05230  Central carbon metabolism in cancer
oaa05231  Choline metabolism in cancer
Module
oaa_M00687  MAPK (ERK1/2) signaling
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100087942
   04015 Rap1 signaling pathway
    100087942
   04010 MAPK signaling pathway
    100087942
   04012 ErbB signaling pathway
    100087942
   04370 VEGF signaling pathway
    100087942
   04371 Apelin signaling pathway
    100087942
   04066 HIF-1 signaling pathway
    100087942
   04068 FoxO signaling pathway
    100087942
   04072 Phospholipase D signaling pathway
    100087942
   04071 Sphingolipid signaling pathway
    100087942
   04024 cAMP signaling pathway
    100087942
   04022 cGMP - PKG signaling pathway
    100087942
   04151 PI3K-Akt signaling pathway
    100087942
   04150 mTOR signaling pathway
    100087942
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    100087942
  Cell growth and death
   04210 Apoptosis
    100087942
   04218 Cellular senescence
    100087942
  Cellular community - eukaryotes
   04540 Gap junction
    100087942
   04550 Signaling pathways regulating pluripotency of stem cells
    100087942
  Cell motility
   04810 Regulation of actin cytoskeleton
    100087942
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    100087942
   04650 Natural killer cell mediated cytotoxicity
    100087942
   04660 T cell receptor signaling pathway
    100087942
   04662 B cell receptor signaling pathway
    100087942
   04664 Fc epsilon RI signaling pathway
    100087942
  Endocrine system
   04910 Insulin signaling pathway
    100087942
   04912 GnRH signaling pathway
    100087942
   04915 Estrogen signaling pathway
    100087942
   04917 Prolactin signaling pathway
    100087942
   04921 Oxytocin signaling pathway
    100087942
   04926 Relaxin signaling pathway
    100087942
   04919 Thyroid hormone signaling pathway
    100087942
   04916 Melanogenesis
    100087942
  Circulatory system
   04270 Vascular smooth muscle contraction
    100087942
  Nervous system
   04720 Long-term potentiation
    100087942
   04730 Long-term depression
    100087942
   04722 Neurotrophin signaling pathway
    100087942
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100087942
   05230 Central carbon metabolism in cancer
    100087942
   05231 Choline metabolism in cancer
    100087942
   05206 MicroRNAs in cancer
    100087942
   05205 Proteoglycans in cancer
    100087942
   05210 Colorectal cancer
    100087942
   05225 Hepatocellular carcinoma
    100087942
   05226 Gastric cancer
    100087942
   05214 Glioma
    100087942
   05216 Thyroid cancer
    100087942
   05221 Acute myeloid leukemia
    100087942
   05220 Chronic myeloid leukemia
    100087942
   05218 Melanoma
    100087942
   05211 Renal cell carcinoma
    100087942
   05219 Bladder cancer
    100087942
   05215 Prostate cancer
    100087942
   05213 Endometrial cancer
    100087942
   05224 Breast cancer
    100087942
   05223 Non-small cell lung cancer
    100087942
  Neurodegenerative diseases
   05020 Prion diseases
    100087942
  Endocrine and metabolic diseases
   04934 Cushing's syndrome
    100087942
  Infectious diseases
   05164 Influenza A
    100087942
   05161 Hepatitis B
    100087942
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100087942
   05165 Human papillomavirus infection
    100087942
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    100087942
   01522 Endocrine resistance
    100087942
Enzymes [BR:oaa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100087942
Protein kinases [BR:oaa01001]
 Serine/threonine kinases: STE group
  STE7 family
   100087942
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase APH Seadorna_VP7 Kdo
Motif
Other DBs
NCBI-GeneID: 100087942
NCBI-ProteinID: XP_007656905
Position
Un
AA seq 261 aa AA seqDB search
MEDGFQSYQGSLQLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICME
HMDGGSLDQVLKEAKRIPEEILGKVSIAVLRGLAYLREKHQIMHRDVKPSNILVNSRGEI
KLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVELAIGRYPIP
PPDTKELEAIFGRPVVDGAEGEPSSISPRPRPPGRPISGHGMDSRPAMAIFELLDYIVNE
PPPKLPNGVFTQDFQEFVNKW
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggaggatggattccagtcataccaaggttccttgcagttgattcacctggagatcaaa
cctgccattcgcaaccagatcattcgggaactccaggtcctacacgagtgcaattcgcct
tacattgtgggcttctatggagccttttatagcgatggggaaatcagcatctgcatggag
cacatggatggagggtctctggatcaggtgttaaaagaagccaagagaattcctgaagag
atcttggggaaagtcagcattgcagttctgcgcggtttggcatatctgagagagaaacac
cagattatgcacagagacgtgaaaccctccaacatccttgtcaactcccggggagagatc
aagttgtgtgattttggggtgagcgggcagctcatcgactccatggctaactccttcgta
ggaacccgctcctacatgtctccggagcggttgcaaggcactcactactcagttcagtcc
gatatctggagtatgggcctgtccctagtagagctggccatcggaagatacccaatcccc
cctccagacaccaaggaattagaagcgatctttggacggcccgtggtcgatggggcagag
ggagagccctccagcatctctccgcggccacgacccccaggacgcccaatcagtggccac
gggatggatagtcgaccagccatggccatctttgaactgttggactacattgttaacgag
cctccacctaaacttccgaacggggttttcacgcaagacttccaggagtttgtaaataaa
tggtaa

DBGET integrated database retrieval system