KEGG   Ornithorhynchus anatinus (platypus): 100088070Help
Entry
100088070         CDS       T01045                                 

Definition
histone-lysine N-methyltransferase SUV420H1-like
Orthology
K11429  
histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100088070
Enzymes [BR:oaa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100088070
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 256 aa AA seqDB search
RLPPCVFQVFIYLRMFATDSGFEILPCNRYSSEQNGAKIVATKEWKRNDKIELLVGCIAE
LSEAEENLLLRHGDNDFSVMYSTRKNCAQLWLGPAAFINHGDIKLSKDHDNDNSLYVAKL
NNGFGHGGLGGHGGGHGGGGPTKLKIQLKREAEGRGGDGGACCPDPLGLLDARHHADGTD
LGQYEDGSTDPSSSSSSSSSSSDEDDDGDGEYDDEFEDDFIPLPPAKRLRLIVGKDSIDI
DISSRRREDQSLRPNA
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
cgcctgcctccgtgtgtgttccaggtgtttatttatttgcggatgtttgcgacggacagc
gggtttgaaatcctgccgtgcaaccggtactcgtccgagcagaacggagccaagatcgtc
gccacgaaggaatggaagaggaacgacaagattgagctcctggtgggctgcatcgcggag
ctgtcagaggcggaggagaacctgctgctgcggcacggcgacaacgacttcagcgtcatg
tactcgacccggaagaactgcgcccagctctggctcggccccgccgccttcatcaaccac
ggtgacatcaagctgagcaaggaccacgacaacgacaacagcctctacgtggccaagctc
aacaacggcttcggccacggcgggctgggcggccacggcggcggccacggcggcggcggc
cccaccaagctgaagatccagctgaagcgggaggccgagggccggggcggggacggcggg
gcctgctgccccgaccccctgggcctgctggacgcgcggcatcacgccgacgggaccgac
ttgggccagtacgaggacggcagcacggacccgtcgtcgtcgtcctcctcctcctcctct
tcctcggatgaagacgacgacggggacggggagtacgacgacgagttcgaggacgatttc
atccccctgcccccagccaagcggctgcgcctcatcgtgggcaaggactcgatcgacatc
gacatctcctccaggcgcagggaggaccagtccctgaggcctaacgcgtga

DBGET integrated database retrieval system