KEGG   Ornithorhynchus anatinus (platypus): 100088087Help
Entry
100088087         CDS       T01045                                 

Definition
Pyruvate dehydrogenase [lipoamide] kinase-like
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 325 aa AA seqDB search
MNAARLMLRGAGSLSSSVPREVEHFSRYSPSPLSIKQLLDFGTENACERTSFAFLRQELP
VRLANILKEIDILPDRLVNTSSVQTVLNRYIQSLMDLVEFHEKNPDDQKALSDFIDALIT
VRNRNHNVVPTMAQGIIEYKDACPVDLVTNQNLQYFLDRFYMNRISTRMLMNQHILIFSD
TKTGNPSHIGSIDPNCDVVSVVQDAFESSRLLCDQYYLTSPELKLTQVNGKVPGQPIHIV
YVPSHLHHMLFELFKNAMRATVEHQENCPSLSPIEVTVVLGKEDLTIKISDRGGGVPLRI
TDRLFSYTYTTAPTPVMDNSRNAPL
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaatgccgcccgcctgatgctgcggggcgccgggtccctgagcagcagcgtcccgcgg
gaggtggagcacttctcccgctacagcccctcgcccctgtccatcaagcagctgctggac
ttcggtaccgaaaatgcctgcgagaggacttcctttgcctttctgcggcaagaactgccg
gtgaggctggcaaatatcctgaaggaaattgatattcttcccgatcggctggtgaacacc
tcttcggtgcaaactgttcttaacaggtacattcaaagcctgatggacttggtggagttc
catgagaaaaacccagatgaccaaaaggctctatctgactttatagatgccctcatcacc
gtccgaaatcgaaatcacaatgtggtccccacgatggcgcaagggataatcgaatacaaa
gacgcctgccccgtggatctggtgaccaatcagaacctccagtatttcctggaccggttc
tacatgaaccgcatttccacccggatgctcatgaaccaacacatccttatatttagtgac
acgaaaactggaaacccaagccacatcgggagcattgatccaaactgtgacgtggtgtca
gtggtacaagatgcctttgagagttcccgcctgctctgcgaccagtattatttaacttct
ccggaactgaagctcacccaagtgaacgggaaagtccccggccagcccatccacatagtg
tacgttccttctcacttgcaccatatgctgttcgagctatttaagaacgccatgagggcc
actgtggagcaccaagaaaattgcccttccctgtctcccatcgaggtgaccgtggtcctg
gggaaagaagacctaaccatcaagatttcggaccgagggggaggcgtccccttgaggata
actgaccgcctgtttagctacacgtacacgacggcgccgaccccggtgatggacaactct
cgcaacgctcctctg

DBGET integrated database retrieval system