KEGG   Ornithorhynchus anatinus (platypus): 100088087Help
Entry
100088087         CDS       T01045                                 

Gene name
PDK4
Definition
pyruvate dehydrogenase kinase, isozyme 4
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Brite
Enzymes [BR:oaa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     100088087 (PDK4)
Protein kinases [BR:oaa01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   100088087 (PDK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 357 aa AA seqDB search
MNAARLMLRGAGSLSSSVPREVEHFSRYSPSPLSIKQLLDFGTENACERTSFAFLRQELP
VRLANILKEIDILPDRLVNTSSVQTVLNRYIQSLMDLVEFHEKNPDDQKALSDFIDALIT
VRNRNHNVVPTMAQGIIEYKDACPVDLVTNQNLQYFLDRFYMNRISTRMLMNQHILIFSD
TKTGNPSHIGSIDPNCDVVSVVQDAFESSRLLCDQYYLTSPELKLTQVNGKVPGQPIHIV
YVPSHLHHMLFELFKNAMRATVEHQENCPSLSPIEVTVVLGKEDLTIKISDRGGGVPLRI
TDRLFSYTYTTAPTPVMDNSRNAPLVGDSLASSLPRLLVSGGWAPGQRPRSGRRVSA
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgaatgccgcccgcctgatgctgcggggcgccgggtccctgagcagcagcgtcccgcgg
gaggtggagcacttctcccgctacagcccctcgcccctgtccatcaagcagctgctggac
ttcggtaccgaaaatgcctgcgagaggacttcctttgcctttctgcggcaagaactgccg
gtgaggctggcaaatatcctgaaggaaattgatattcttcccgatcggctggtgaacacc
tcttcggtgcaaactgttcttaacaggtacattcaaagcctgatggacttggtggagttc
catgagaaaaacccagatgaccaaaaggctctatctgactttatagatgccctcatcacc
gtccgaaatcgaaatcacaatgtggtccccacgatggcgcaagggataatcgaatacaaa
gacgcctgccccgtggatctggtgaccaatcagaacctccagtatttcctggaccggttc
tacatgaaccgcatttccacccggatgctcatgaaccaacacatccttatatttagtgac
acgaaaactggaaacccaagccacatcgggagcattgatccaaactgtgacgtggtgtca
gtggtacaagatgcctttgagagttcccgcctgctctgcgaccagtattatttaacttct
ccggaactgaagctcacccaagtgaacgggaaagtccccggccagcccatccacatagtg
tacgttccttctcacttgcaccatatgctgttcgagctatttaagaacgccatgagggcc
actgtggagcaccaagaaaattgcccttccctgtctcccatcgaggtgaccgtggtcctg
gggaaagaagacctaaccatcaagatttcggaccgagggggaggcgtccccttgaggata
actgaccgcctgtttagctacacgtacacgacggcgccgaccccggtgatggacaactct
cgcaacgctcctctggtaggagattctctggcttcttctctccccaggctgcttgtttcg
ggtggttgggccccggggcagcggccgagatctggacgcagagtctcggct

DBGET integrated database retrieval system