KEGG   Ornithorhynchus anatinus (platypus): 100088193Help
Entry
100088193         CDS       T01045                                 

Gene name
PDIA3
Definition
(RefSeq) protein disulfide isomerase family A member 3
  KO
K08056  
protein disulfide isomerase family A, member 3 [EC:5.3.4.1]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Protein processing in endoplasmic reticulum
Antigen processing and presentation
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100088193 (PDIA3)
 Organismal Systems
  Immune system
   04612 Antigen processing and presentation
    100088193 (PDIA3)
Enzymes [BR:oaa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100088193 (PDIA3)
Chaperones and folding catalysts [BR:oaa03110]
 Protein folding catalysts
  Protein disulfide isomerase
   100088193 (PDIA3)
Membrane trafficking [BR:oaa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    100088193 (PDIA3)
Exosome [BR:oaa04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100088193 (PDIA3)
  Exosomal proteins of colorectal cancer cells
   100088193 (PDIA3)
  Exosomal proteins of bladder cancer cells
   100088193 (PDIA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 459 aa AA seqDB search
MLVEFFAPWCGHCKRLAPEYEAAATRLKGIVPLAKVDCTANSNTCNKYGVSGYPTLKIFR
NGEESGAYDGPRTADGIVSHLKKQAGPASIPLHSDDEFEKFISDKDASVVGFFKDLFSEA
HSEFLKAASNLRDNYRFAHTGQEKLVKKYEPDGEGITLFRPSRLANKFEDNTVRYTEDKI
TSGKIKKFIQENIFGICPHMTEDNKDLIQGKDLLIAYYDVDYEKNAKGSNYWRNRVMMVA
RKFLDAGQKLNFAVASRKTFGHELSEFGLDSTTGEVPVVAIRTAKGEKFVMQEEFSRDGK
ALERFLQDYFDGNLKKYLKSEPVPENNDGPVKVVVAENFDEIVNDEDKDVLIEFYAPWCG
HCKNLEPKYKELGEKLSKDPNIVIAKMDATANDVPSPYEVRGFPTIYFSPANKKQSPKKY
EGGREVSDFLSYLQREATNPPVIQEEEKPKKKKKAQEDL
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgctcgtcgagttcttcgcgccctggtgcggacactgcaagaggcttgcccctgaatat
gaagctgctgcgaccagactcaaaggaatagtcccgttagcaaaggttgattgcaccgcc
aactccaacacctgtaataaatacggagtcagtggctatcccactctgaagatcttcagg
aacggcgaagaatcgggtgcctatgatgggcccaggacagcagatgggattgtcagccac
ttaaagaagcaggcgggacccgcctccattcccctccattctgacgatgagtttgagaag
ttcatcagtgacaaagatgcttctgtggtaggcttcttcaaagatctcttcagtgaggct
cattcagagttcttgaaagccgccagcaatctgagggacaactatcgttttgcacacact
ggtcaggagaagcttgtgaagaagtatgagcccgatggagaagggatcaccctgttccga
ccctcacgcctggccaacaagtttgaggacaacactgtgaggtacacggaggataagata
accagcggaaaaattaagaaattcatccaggagaacatttttggaatctgccctcacatg
acagaagacaacaaagatctgatccaaggcaaagacctgcttatagcctactatgatgtg
gactacgagaaaaatgctaagggttccaactactggcgcaacagggtgatgatggtggct
cggaaattcctggacgccgggcagaaactcaacttcgccgtggctagccgcaagacattc
ggccatgagctttccgaatttggcttggacagcaccactggagaggttcccgttgtggct
atcaggactgccaaaggagagaagttcgtcatgcaggaggagttctcgcgcgacggaaaa
gctctggagaggttcctgcaggattacttcgatggcaacctgaagaagtacctcaagtcg
gagcccgtcccagagaacaacgacgggcccgtgaaggtggtggtagctgagaacttcgat
gaaatcgtgaacgatgaagacaaggatgtcctgattgaattttacgccccttggtgtggc
cactgcaagaacctggagcccaagtacaaagagctgggagagaagctcagtaaagaccct
aacattgtcatagccaagatggacgccaccgccaatgacgtgccttctccgtatgaagtc
agaggcttccctaccatctacttctctccagccaacaagaagcaaagtccaaagaaatac
gaggggggccgtgaggtgagcgacttcctgagctacctgcagcgagaagcgacaaacccg
cccgtgatacaagaggaagagaagcccaagaagaagaagaaggcacaggaagatctctaa

DBGET integrated database retrieval system