KEGG   Ornithorhynchus anatinus (platypus): 100088193Help
Entry
100088193         CDS       T01045                                 

Gene name
PDIA3
Definition
protein disulfide isomerase family A, member 3
Orthology
K08056  
protein disulfide isomerase family A, member 3 [EC:5.3.4.1]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Protein processing in endoplasmic reticulum
Antigen processing and presentation
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100088193 (PDIA3)
 Organismal Systems
  Immune system
   04612 Antigen processing and presentation
    100088193 (PDIA3)
Enzymes [BR:oaa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100088193 (PDIA3)
Exosome [BR:oaa04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100088193 (PDIA3)
  Exosomal proteins of colorectal cancer cells
   100088193 (PDIA3)
  Exosomal proteins of bladder cancer cells
   100088193 (PDIA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 475 aa AA seqDB search
IHNFESRVADTGSAGLMLVEFFAPWCGHCKRLAPEYEAAATRLKGIVPLAKVDCTANSNT
CNKYGVSGYPTLKIFRNGEESGAYDGPRTADGIVSHLKKQAGPASIPLHSDDEFEKFISD
KDASVVGFFKDLFSEAHSEFLKAASNLRDNYRFAHTGQEKLVKKYEPDGEGITLFRPSRL
ANKFEDNTVRYTEDKITSGKIKKFIQENIFGICPHMTEDNKDLIQGKDLLIAYYDVDYEK
NAKGSNYWRNRVMMVARKFLDAGQKLNFAVASRKTFGHELSEFGLDSTTGEVPVVAIRTA
KGEKFVMQEEFSRDGKALERFLQDYFDGNLKKYLKSEPVPENNDGPVKVVVAENFDEIVN
DEDKDVLIEFYAPWCGHCKNLEPKYKELGEKLSKDPNIVIAKMDATANDVPSPYEVRGFP
TIYFSPANKKQSPKKYEGGREVSDFLSYLQREATNPPVIQEEEKPKKKKKAQEDL
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
attcacaacttcgagagccgcgtggccgacacgggctccgccggcctcatgctcgtcgag
ttcttcgcgccctggtgcggacactgcaagaggcttgcccctgaatatgaagctgctgcg
accagactcaaaggaatagtcccgttagcaaaggttgattgcaccgccaactccaacacc
tgtaataaatacggagtcagtggctatcccactctgaagatcttcaggaacggcgaagaa
tcgggtgcctatgatgggcccaggacagcagatgggattgtcagccacttaaagaagcag
gcgggacccgcctccattcccctccattctgacgatgagtttgagaagttcatcagtgac
aaagatgcttctgtggtaggcttcttcaaagatctcttcagtgaggctcattcagagttc
ttgaaagccgccagcaatctgagggacaactatcgttttgcacacactggtcaggagaag
cttgtgaagaagtatgagcccgatggagaagggatcaccctgttccgaccctcacgcctg
gccaacaagtttgaggacaacactgtgaggtacacggaggataagataaccagcggaaaa
attaagaaattcatccaggagaacatttttggaatctgccctcacatgacagaagacaac
aaagatctgatccaaggcaaagacctgcttatagcctactatgatgtggactacgagaaa
aatgctaagggttccaactactggcgcaacagggtgatgatggtggctcggaaattcctg
gacgccgggcagaaactcaacttcgccgtggctagccgcaagacattcggccatgagctt
tccgaatttggcttggacagcaccactggagaggttcccgttgtggctatcaggactgcc
aaaggagagaagttcgtcatgcaggaggagttctcgcgcgacggaaaagctctggagagg
ttcctgcaggattacttcgatggcaacctgaagaagtacctcaagtcggagcccgtccca
gagaacaacgacgggcccgtgaaggtggtggtagctgagaacttcgatgaaatcgtgaac
gatgaagacaaggatgtcctgattgaattttacgccccttggtgtggccactgcaagaac
ctggagcccaagtacaaagagctgggagagaagctcagtaaagaccctaacattgtcata
gccaagatggacgccaccgccaatgacgtgccttctccgtatgaagtcagaggcttccct
accatctacttctctccagccaacaagaagcaaagtccaaagaaatacgaggggggccgt
gaggtgagcgacttcctgagctacctgcagcgagaagcgacaaacccgcccgtgatacaa
gaggaagagaagcccaagaagaagaagaaggcacaggaagatctctaa

DBGET integrated database retrieval system