KEGG   Ornithorhynchus anatinus (platypus): 100088408Help
Entry
100088408         CDS       T01045                                 

Gene name
USP49
Definition
ubiquitin specific peptidase 49
Orthology
K11834  
ubiquitin carboxyl-terminal hydrolase 44/49 [EC:3.1.2.15]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 571 aa AA seqDB search
MTLDLSDTEDLFARAPGGPAAGARGRPGPPGGLNGGAASGQSLELIQPKEPSSKHISLCH
ELHTLFRVMWSGKWALVSPFAMLHSVWSLIPAFRGYDQQDAQEFLCELLDKVQQELESEG
TKRRILIPFSQRKLTKQVLKVVNTIFHGQLLSQVTCITCNYKSNTIEPFWDLSLEFPERY
HCLKKGIVPCNQTECMLTEMLAKFTETEALEGRIYTCDHCRSKRRKSSPKPLLLSEAKKQ
LMIYRLPQVLRLHLKRFRWSGRNHREKIGVHVVFEQVLTMEPYCCRDTLSSLEKEAFAYD
LSAVVMHHGKGFGSGHYTAYCYNTEGGFWVHCNDSKLNVCSVEEVCKTQAYILFYTQRTV
QGSADVSANHLRAQGPSGNSFRHTGPLIPPFRARVSVALGDSQRGQLQRGRATGRGRPAE
ASRSVPAPGRRLSPALAREESRRGRLRPPPEGRTEAKRAGRLRDGALLPCLHLLGRHRAK
QAPVRHARLGTAPTHWAPWGSSPGRDREGGREGIQDPILCPAEQARLHPSAPWRIGAFED
GLLLSRQRPAGGRVARGEAGPPAPAPMTHGK
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgaccctcgacctatccgacaccgaagacctcttcgccagggcgcccggcgggccggcg
gccggggcccgggggcggccgggcccgccgggcggcctcaacggcggggcggcctccggc
cagagcctggagctgatccagcccaaggagcccagctccaagcacatctccctctgccac
gaactgcacaccctcttccgcgtcatgtggtccgggaagtgggccctggtgtccccgttc
gccatgctgcactccgtgtggagcctgatcccggccttccgcggctacgaccagcaggac
gcgcaggagttcctctgcgagctgctggacaaggtgcagcaggagctggagtcggagggc
accaagcgcaggatcctcatccccttctcccagaggaagctcaccaagcaggtgctcaaa
gtggtcaacaccatatttcacggccagctgctcagccaggtcacctgcatcacctgcaac
tacaaatccaacaccatcgagcccttctgggatctgtccctggagtttcccgaacgctat
cactgcctaaagaagggcatcgtcccttgcaatcagaccgaatgcatgctcacagagatg
ttggccaaattcacggaaacggaggctctggaagggaggatctacacgtgcgaccactgc
aggagcaaaaggcgcaaatcctctcccaaacctctcctcctgagtgaagctaaaaagcag
ttaatgatctacagactacctcaggtcctccgactgcaccttaaacgattcaggtggtct
ggacggaatcaccgggagaagatcggggtccatgtcgtctttgagcaggtattaaccatg
gaaccttactgctgcagggacaccctctcctctcttgagaaagaggcctttgcctatgac
ctctccgcggtggtgatgcatcacgggaaagggtttggctcaggacactacacagcatat
tgctacaacacagagggaggtttctgggtccactgtaacgactctaagctgaatgtatgt
agtgtggaggaagtgtgcaagacccaggcctacattcttttttacactcagagaacagtg
cagggcagcgcggacgtctcagcgaaccacctccgagctcaggggccgtccgggaactcc
tttcgccacactgggcctttaataccacctttccgggctcgggtgtccgttgctttgggc
gactcccaaagggggcagctccaaagggggcgtgccacgggccgggggaggccagcggaa
gccagccggtcggtgccggccccggggagacgcttgagccccgccctggctcgagaagag
agccggagaggcaggctaaggccgcccccggagggcaggaccgaggccaagagggccggg
cgtctccgggacggagccctcctaccctgtcttcacctgcttggccgtcaccgggcaaag
caggccccggtccggcacgcacggttgggcaccgcccccacccactgggcaccttggggc
tcttcaccgggccgggacagggaaggagggagggagggcattcaggatcctattctttgc
ccagctgaacaggcccggctccacccttccgctccctggagaatcggggcgtttgaagac
ggccttctgctatcccgccagaggcccgccggcggccgggtggcccgcggggaggccggt
ccccctgcccccgcacccatgacccacgggaaatga

DBGET integrated database retrieval system