KEGG   Ornithorhynchus anatinus (platypus): 100088442Help
Entry
100088442         CDS       T01045                                 

Definition
ubiquitin carboxyl-terminal hydrolase 28-like
Orthology
K11849  
ubiquitin carboxyl-terminal hydrolase 25/28 [EC:3.1.2.15]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Brite
Enzymes [BR:oaa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100088442
Peptidases [BR:oaa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100088442
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 317 aa AA seqDB search
SCQKLLRQLKEITGIQDPSFLHEALKASDGDITQAVSLLTDERVREPSRDAAAEPSESEG
SAASQESSAKVIDLTHDNKDDLQAAIALSLLESPKIPADQRDLDRVQGAAAESKRPKRKR
CEVWGEDPNPNTWRRVSGWPVGLKNVGNTCWFSAVIQSLFQLPEFRRLVLGYSLPPNLKE
NCRSHAEKRNIVFMQELQYLEFTHKLLDRLEDAFQLAVNVRPRRRPTRPTMLEFVMRSLC
AERRSERPGETWRPEVTSSSLLPGKTFSNIETFGQYPLQVNGHRNLNECLEGAMVEGEIE
MAPSDRSAKYGQEVMTT
NT seq 950 nt NT seq  +upstreamnt  +downstreamnt
agctgccagaagctgttaaggcagctgaaggagatcactggcatccaggacccttccttt
ctccacgaggccttgaaggccagcgacggtgacataacccaggccgtcagcctcctcacc
gacgagcgggtgcgagagcccagccgggatgctgccgccgaaccttcggagagcgaggga
agtgctgccagccaagaaagctcggccaaagtgatcgacctgactcacgacaacaaagat
gacctccaggcagccattgctctgagtctgctggagtccccgaaaattccagcggaccag
agagatctcgacagggttcaaggggcggcggccgagagcaagcgccccaagaggaaacgc
tgcgaggtctggggggaggaccccaaccccaacacctggaggcgagtgagcggctggccc
gtggggctgaagaacgtcggcaacacctgctggttcagcgcggtcattcagtctctcttc
caactgcccgagtttcgaaggctcgtgctcggctacagcctcccgccgaatttaaaggaa
aattgccggagccacgcggagaagagaaacatcgtgtttatgcaggagcttcagtatctc
gagttcacgcacaagctgctggaccggctggaggacgccttccagttggccgttaacgtc
aggccacggagacgtccgacccgaccgacgatgttggaatttgtcatgcgctcgctctgc
gcagagcgccgttctgagcgcccgggggagacgtggcggccggaggtcacctcctcctcc
ctccttccaggcaagaccttctccaacatcgagaccttcggccagtatcccctgcaggtg
aacggtcaccggaacctgaacgagtgcctggaaggggccatggtggagggggagatcgag
atggctccttccgaccggtcggccaagtatggacaagaggtaatgacgac

DBGET integrated database retrieval system