KEGG   Ornithorhynchus anatinus (platypus): 100088442Help
Entry
100088442         CDS       T01045                                 

Definition
ubiquitin carboxyl-terminal hydrolase 28-like
Orthology
K11849  
ubiquitin carboxyl-terminal hydrolase 25/28 [EC:3.1.2.15]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 286 aa AA seqDB search
SCQKLLRQLKEITGIQDPSFLHEALKASDGDITQAVSLLTDERVREPSRDAAAEPSESEG
SAASQESSAKVIDLTHDNKDDLQAAIALSLLESPKIPADQRDLDRVQGAAAESKRPKRKR
CEVWGEDPNPNTWRRVSGWPVGLKNVGNTCWFSAVIQSLFQLPEFRRLVLGYSLPPNLKE
NCRSHAEKRNIVFMQELHEFTHKLLDRLEDAFQLAVNVRTHPSSATGPLRDRDLRAGKTF
SNIETFGQYPLQVNGHRNLNECLEGAMVEGEIEMAPSDRSAKYGQE
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
agctgccagaagctgttaaggcagctgaaggagatcactggcatccaggacccttccttt
ctccacgaggccttgaaggccagcgacggtgacataacccaggccgtcagcctcctcacc
gacgagcgggtgcgagagcccagccgggatgctgccgccgaaccttcggagagcgaggga
agtgctgccagccaagaaagctcggccaaagtgatcgacctgactcacgacaacaaagat
gacctccaggcagccattgctctgagtctgctggagtccccgaaaattccagcggaccag
agagatctcgacagggttcaaggggcggcggccgagagcaagcgccccaagaggaaacgc
tgcgaggtctggggggaggaccccaaccccaacacctggaggcgagtgagcggctggccc
gtggggctgaagaacgtcggcaacacctgctggttcagcgcggtcattcagtctctcttc
caactgcccgagtttcgaaggctcgtgctcggctacagcctcccgccgaatttaaaggaa
aattgccggagccacgcggagaagagaaacatcgtgtttatgcaggagcttcacgagttc
acgcacaagctgctggaccggctggaggacgccttccagttggccgttaacgtcagaacg
catcccagttctgccaccggcccgctgcgggaccgggacctgcgggcaggcaagaccttc
tccaacatcgagaccttcggccagtatcccctgcaggtgaacggtcaccggaacctgaac
gagtgcctggaaggggccatggtggagggggagatcgagatggctccttccgaccggtcg
gccaagtatggacaagag

DBGET integrated database retrieval system