KEGG   Ornithorhynchus anatinus (platypus): 100088491Help
Entry
100088491         CDS       T01045                                 

Gene name
DYRK1B
Definition
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1B
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Brite
Enzymes [BR:oaa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100088491 (DYRK1B)
Protein kinases [BR:oaa01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   100088491 (DYRK1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 648 aa AA seqDB search
MAAPPGHGPFSGGRQPPQGLPDVQLLPRRLPLSFRDATSAPLRRLSVDLIKTYKHINEVY
YAKKKRRAQQGPPEDSSTKKERKVLNRGYDDDNHDYIVRSGERWLERYEIDSLIGKGSFG
QVRGGGPVADWPARDEDPVVRPGSPRLRYLVSRGAAELHLKRHFMFRSHLCLVFELLSYN
LYDLLRNTHFRGVSLSLTRKLAQQLCTALLFLATPELSIIHCDLKPENILLCNPKRSAIK
IVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGAPYDLAIDMWSLGCILVEMHTGEPLFSGS
NEVDQMNRIVEVLGLPPAPMLDQAPKARKYFDRLPDGGWTLRRGKDLGKEYRGPGKRRLQ
EVLGVDSGGPGGRRAGEPGHSPADYLKFQDLVLRMLEYQPAARISPLGALQHGFFRPRAA
DEATDTGPPPPPARAGRAAASTSPAPDTSHSSSTASSVSSSGGSSGSSNGNRGYRYSQRY
RGGPGSLSTDCDMPSPQAPPPVVQPHLPHWAGGDTGNGAGAEGGPQRPPHKPPPAPPSFH
PAARPARPPGSSPPPVPMEEGPAPAPAPPPPPPPPPAPAPAPSADCSPVAPGPGPGPPLL
LPGSAFRTRTAGGSAPRGRGPRPLASEEPGLPPGLGLRGVPQSTAASS
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgccgccgggccatgggcctttctccggcgggcgccagcctccgcaggggctg
ccagatgttcagctgctgcctcggcgactcccgctgtcgttccgggatgcgacgtcggcc
cccctgcgcaggttgtccgtggacctcatcaagacgtacaagcacatcaacgaggtctat
tatgcgaagaagaagcggcgtgctcagcaaggcccccccgaggactccagcaccaagaag
gaacggaaggtgttgaaccgcggttacgacgacgacaaccacgactacatagttcgcagt
ggggagcgttggctggagagatatgagatcgactcgctcatcgggaagggctccttcgga
caggtgcggggtggcggaccggtggcggactggccggctcgggacgaggaccctgtggtc
agacccgggtccccccgcctaagatacttggtatctcggggggccgcggagctgcatctg
aagcgtcacttcatgttccggagccacctgtgcctggtgttcgagctgctctcctacaac
ctgtacgacctcctgcgcaacacccacttccgcggggtgtccctcagcctgacgcgcaag
ctggcgcagcagctgtgcacggccctgctcttcctggccacgcccgagctcagcatcatc
cactgcgacctgaagcccgagaacattctgctctgcaaccccaagcgcagcgctatcaag
atcgttgactttggcagttcctgccagcttgggcagcggatctaccagtacatccagagc
cgcttctaccgctctccggaggtcctgctgggcgcgccctacgacctggccatcgacatg
tggtctctgggctgcatcctcgtggagatgcacacaggcgagcccctcttcagcggttcc
aacgaggtggaccagatgaaccggatcgtggaggtgctggggctgccccccgcgcccatg
ctggaccaggctcccaaggcccggaaatacttcgaccgactgccggacgggggctggact
ctgcgcaggggcaaggacctcggcaaggagtaccggggtccgggcaagcggcggctgcag
gaggtgctgggggtggactcgggcggccccgggggccggcgggccggggagccgggacac
agccccgccgactacctcaagttccaggacctggtgctgcgcatgctcgagtaccagccc
gccgcccgcatcagccccctgggggccctgcagcacggtttcttccgtccccgcgccgcc
gacgaggccaccgacaccggccccccgcccccgcccgccagggccgggcgcgccgccgcc
tccacctcccccgcccccgacacctcccactcctccagcaccgccagctccgtctccagc
tcgggtggctccagcggctcctccaatgggaaccgcggctaccgctacagccagcgctac
cgcggagggcccggctccctctccaccgattgcgacatgcccagcccccaggctccacct
cccgtcgtgcagccccatctcccccactgggccgggggggacacggggaacggggccgga
gcggagggcggaccccagcggccgccccacaagcctccgcccgctccaccctccttccat
cctgcggcccgccccgcccgcccgcccgggagttcgccgccacctgtcccgatggaggaa
ggcccggccccggccccggccccgccaccgcctcctcctcctcctccagctccggcccct
gctccttcagcagactgctctcctgtggccccgggcccgggcccgggccctcctctcctc
ctccccggctctgccttccggactcggaccgccggggggagcgccccccgggggaggggg
ccgcggccgctggcctccgaagagccgggcctgccccccgggctcggcctccgaggggtc
ccccagagcacggctgccagttcctga

  All links  
No link information was found.   
DBGET integrated database retrieval system