KEGG   Ornithorhynchus anatinus (platypus): 100088536Help
Entry
100088536         CDS       T01045                                 

Definition
ribonuclease P protein subunit p20-like
Orthology
K14527  
ribonuclease P/MRP protein subunit RPP20 [EC:3.1.26.5]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Ribosome biogenesis in eukaryotes
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:oaa03013]
Genetic Information Processing; Translation; Ribosome biogenesis in eukaryotes [PATH:oaa03008]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 140 aa AA seqDB search
MAENRQPRGGETDLDPGEYTLRKRLPHRLPRRPNDIYVNMKTDFKAQLARCQKLLGPAGG
PGSGGWPEIYIHGLGLAINRAINIALQLQAGSFGALQVAANTSTVELVDELEPEADDREP
LTRTRNNSAIHIRVFHVTPK
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atggcggagaaccgtcagccccgcgggggcgagaccgacctggaccccggagagtacacc
ctgcgtaagaggctccctcaccgcctcccccgccggcccaacgacatctacgtcaacatg
aagacggacttcaaggcccagctggcccgctgccagaagctgctgggccccgcgggcggc
ccgggcagcgggggctggcccgagatctacatccacggcctgggcctggccatcaaccgg
gccatcaacatcgccctgcagctgcaggcgggcagcttcggcgccctgcaggtggccgcc
aacacgtccaccgtggagctggtggacgagctggagcccgaggccgacgaccgggagccc
ctgacgcgcacgcgcaacaattccgccatccacatccgcgtcttccacgtcacccccaag
taa

DBGET integrated database retrieval system