KEGG   Ornithorhynchus anatinus (platypus): 100088550Help
Entry
100088550         CDS       T01045                                 

Definition
T-cell ecto-ADP-ribosyltransferase 1-like
Orthology
K00775  
NAD(P)-arginine ADP-ribosyltransferase [EC:2.4.2.31]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Brite
Enzymes [BR:oaa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     100088550
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 225 aa AA seqDB search
MTMEYNAFDDQYKGCEEKMDSKAPQLLKDEKRCNKVLRDAWNSAKTKWQKEIEKKVSPLP
SDFRKQYGIAVIMYTNKTFSKDFNRAVRTNGRSLEDYKENFHYKAIHYYLTRALQLLPKV
NFTTKLYRGSQNKFTYRGTGPIRFGQFCSTSQDRSISAQFGNRTFYTIRAWLGVYIKNFS
YYPEEKEVLIPGNEVFHVSAKKGQGAFNLKSKRKPLSCFNCALLG
NT seq 676 nt NT seq  +upstreamnt  +downstreamnt
atgaccatggagtacaatgcttttgatgaccagtataagggatgtgaagaaaaaatggat
tccaaagctccccaactcctgaaggatgaaaagaggtgcaacaaagtcctccgtgatgcc
tggaacagtgccaagaccaagtggcagaaagagatcgagaagaaggtgtctcccctcccc
tctgacttcagaaagcagtatgggatagcggtcattatgtacaccaataaaacctttagt
aaagacttcaaccgggccgtgcggacaaacgggaggtctctagaggactataaggaaaat
tttcactataaagccatccactactatctgaccagggccctgcagctcctgccaaaggtc
aatttcaccacaaagctttatcggggctctcagaacaagttcacttacagagggactggc
cccatccgcttcggacagttctgctccacctcccaggatcgttcgataagtgctcagttt
ggtaatcgcaccttctacaccatccgtgcctggttgggggtgtacatcaagaatttctca
tattacccagaagagaaggaagtgctgatcccagggaatgaagtcttccatgtttcagca
aagaaggggcaaggggctttcaacctgaagagtaaaaggaagcctttatcctgcttcaac
tgtgccctcctgggaa

DBGET integrated database retrieval system