KEGG   Ornithorhynchus anatinus (platypus): 100088657Help
Entry
100088657         CDS       T01045                                 

Definition
mitogen-activated protein kinase 7-like
Orthology
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
MAPK signaling pathway
Gap junction
Neurotrophin signaling pathway
GnRH signaling pathway
Oxytocin signaling pathway
MicroRNAs in cancer
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:oaa04010]
Cellular Processes; Cell communication; Gap junction [PATH:oaa04540]
Organismal Systems; Endocrine system; GnRH signaling pathway [PATH:oaa04912]
Organismal Systems; Endocrine system; Oxytocin signaling pathway [PATH:oaa04921]
Organismal Systems; Nervous system; Neurotrophin signaling pathway [PATH:oaa04722]
Human Diseases; Cancers; MicroRNAs in cancer [PATH:oaa05206]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 256 aa AA seqDB search
PRSYVVLDLMESDLHQIIHSSQPLTLEHVRYFLYQLLRGLKYMHSAQVIHRDLKPSNLLV
NENCELKIGDFGMARGLCAAPAERQYFMTEYVATRWYRAPELMLSLHEYTQAIDLWSVGC
IFGEMLARRQLFPGKNYVHQLQLIMTVLGTPSPAVIRAVGAERVRAYIQSLPPRQPVPWE
SVYPGADRQALALLGRMLRFEPGGRVSAAAALRHPFLAKYHDPDDEPDCAPPFDFAFDRE
ALTRERIKEAIVAEIE
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
ccccgcagctacgtggtcctggacctgatggagagcgacctgcaccagatcatccactcg
tctcagccgctgaccctggagcacgtgcgctacttcctgtaccagctgctgcgcggcctc
aagtacatgcactcggcccaggtgatccatcgcgacctcaagccctccaacctgttggtg
aacgagaactgcgagctgaagatcggcgacttcggcatggcccgggggctgtgcgccgcc
ccggccgagcgccagtacttcatgacggagtacgtggccacccgctggtaccgcgccccc
gagctgatgctctcgctgcacgagtacacccaggccatcgacctctggtccgtgggctgc
atcttcggggagatgctggcccggcgccagctgttcccgggcaagaactacgtccaccag
ctgcagctgatcatgacggtgctgggcaccccgtccccggccgtgatccgggccgtcggg
gccgagcgggtgcgggcctacatccagagcctgcccccgcgccagccggtgccctgggag
tcggtgtacccgggggccgaccggcaggccctggcgctcctgggccgcatgctgcgcttc
gagccggggggccgggtctcggcggccgccgccctccgccacccgttcctggccaagtac
cacgacccggacgacgagccggactgcgcgccgcccttcgacttcgccttcgaccgggag
gccctgacccgggagcgcatcaaggaggccatcgtggcggagatcgaa

DBGET integrated database retrieval system