KEGG   Ornithorhynchus anatinus (platypus): 100088657Help
Entry
100088657         CDS       T01045                                 

Gene name
MAPK7
Definition
(RefSeq) mitogen-activated protein kinase 7
  KO
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
MAPK signaling pathway
Gap junction
Neurotrophin signaling pathway
GnRH signaling pathway
Oxytocin signaling pathway
MicroRNAs in cancer
Module
MAPK (ERK5) signaling
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100088657 (MAPK7)
 Cellular Processes
  Cellular community
   04540 Gap junction
    100088657 (MAPK7)
 Organismal Systems
  Endocrine system
   04912 GnRH signaling pathway
    100088657 (MAPK7)
   04921 Oxytocin signaling pathway
    100088657 (MAPK7)
  Nervous system
   04722 Neurotrophin signaling pathway
    100088657 (MAPK7)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    100088657 (MAPK7)
Enzymes [BR:oaa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100088657 (MAPK7)
Protein kinases [BR:oaa01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   100088657 (MAPK7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 247 aa AA seqDB search
MESDLHQIIHSSQPLTLEHVRYFLYQLLRGLKYMHSAQVIHRDLKPSNLLVNENCELKIG
DFGMARGLCAAPAERQYFMTEYVATRWYRAPELMLSLHEYTQAIDLWSVGCIFGEMLARR
QLFPGKNYVHQLQLIMTVLGTPSPAVIRAVGAERVRAYIQSLPPRQPVPWESVYPGADRQ
ALALLGRMLRFEPGGRVSAAAALRHPFLAKYHDPDDEPDCAPPFDFAFDREALTRERIKE
AIVAEIE
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atggagagcgacctgcaccagatcatccactcgtctcagccgctgaccctggagcacgtg
cgctacttcctgtaccagctgctgcgcggcctcaagtacatgcactcggcccaggtgatc
catcgcgacctcaagccctccaacctgttggtgaacgagaactgcgagctgaagatcggc
gacttcggcatggcccgggggctgtgcgccgccccggccgagcgccagtacttcatgacg
gagtacgtggccacccgctggtaccgcgcccccgagctgatgctctcgctgcacgagtac
acccaggccatcgacctctggtccgtgggctgcatcttcggggagatgctggcccggcgc
cagctgttcccgggcaagaactacgtccaccagctgcagctgatcatgacggtgctgggc
accccgtccccggccgtgatccgggccgtcggggccgagcgggtgcgggcctacatccag
agcctgcccccgcgccagccggtgccctgggagtcggtgtacccgggggccgaccggcag
gccctggcgctcctgggccgcatgctgcgcttcgagccggggggccgggtctcggcggcc
gccgccctccgccacccgttcctggccaagtaccacgacccggacgacgagccggactgc
gcgccgcccttcgacttcgccttcgaccgggaggccctgacccgggagcgcatcaaggag
gccatcgtggcggagatcgaa

DBGET integrated database retrieval system