KEGG   Ornithorhynchus anatinus (platypus): 100088856Help
Entry
100088856         CDS       T01045                                 

Gene name
RPA2
Definition
replication protein A2, 32kDa
Orthology
K10739  
replication factor A2
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    100088856 (RPA2)
   03420 Nucleotide excision repair
    100088856 (RPA2)
   03430 Mismatch repair
    100088856 (RPA2)
   03440 Homologous recombination
    100088856 (RPA2)
   03460 Fanconi anemia pathway
    100088856 (RPA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 244 aa AA seqDB search
MWNSHGGFESNYGGSSFTGGSYTQSPGGFGSPSASQFEKKSRSRAQHIVPCTVSQLLAAT
QVEETFRIGNIEISQVTIVGIIRHAEKAPTNIVYKVDDMTAAPMDVRQWVDTDEISSENI
VIPPETYVKVAGHLRSFQNRKSLVAFKIIPLEDMNELTTHILETVNAHQTLSKPSGPLIM
GNSVGASGMGDMGSLGGSGSGPTNGLTLHQSQVLNLIKAYPKPEGLSFQELRSQLPNLNA
SVIK
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgtggaacagtcacggagggtttgagagcaactatggcgggagctccttcaccgggggg
agctacacccagtccccgggcggatttggctccccttctgcctcccagtttgagaagaaa
tcacgatcccgagcccagcacattgtgccgtgcaccgtttcccagctgctggccgccacc
caggtcgaagaaacgttcaggatcgggaacatcgagatttcccaggtcactattgtggga
atcatccggcatgcagagaaagccccgaccaacatcgtgtacaaggtggatgacatgacc
gctgcccccatggacgtccggcagtgggtggacacggacgagatcagcagcgagaatatc
gtcatccccccggaaacatacgtcaaggtggctggtcacctccgctccttccagaacaga
aaaagcttggtggcgttcaagatcatccctctggaggatatgaatgagctcaccactcac
atcctggaaaccgtcaacgcccaccaaacgctcagcaagcccagcggcccgctcatcatg
ggcaactctgtcggtgcctcagggatgggcgacatggggagcctgggcgggagcggcagc
ggaccgaccaacgggctcaccctgcaccagagccaggtgctgaatctgatcaaagcctat
cccaagccagaggggctcagcttccaggagctcaggtctcagctgccaaacctgaacgca
tcagtcatcaagtga

  All links  
No link information was found.   
DBGET integrated database retrieval system