KEGG   Ornithorhynchus anatinus (platypus): 100088856Help
Entry
100088856         CDS       T01045                                 

Definition
replication protein A 32 kDa subunit-like
Orthology
K10739  
replication factor A2
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Fanconi anemia pathway
Class
Genetic Information Processing; Replication and repair; DNA replication [PATH:oaa03030]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:oaa03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:oaa03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:oaa03440]
Genetic Information Processing; Replication and repair; Fanconi anemia pathway [PATH:oaa03460]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 244 aa AA seqDB search
MWNSHGGFESNYGGSSFTGGSYTQSPGGFGSPSASQFEKKSRSRAQHIVPCTVSQLLAAT
QVEETFRIGNIEISQVTIVGIIRHAEKAPTNIVYKVDDMTAAPMDVRQWVDTDEISSENI
VIPPETYVKVAGHLRSFQNRKSLVAFKIIPLEDMNELTTHILETVNAHQTLSKPSGPLIM
GNSVGASGMGDMGSLGGSGSGPTNGLTLHQSQVLNLIKAYPKPEGLSFQELRSQLPNLNA
SVIK
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgtggaacagtcacggagggtttgagagcaactatggcgggagctccttcaccgggggg
agctacacccagtccccgggcggatttggctccccttctgcctcccagtttgagaagaaa
tcacgatcccgagcccagcacattgtgccgtgcaccgtttcccagctgctggccgccacc
caggtcgaagaaacgttcaggatcgggaacatcgagatttcccaggtcactattgtggga
atcatccggcatgcagagaaagccccgaccaacatcgtgtacaaggtggatgacatgacc
gctgcccccatggacgtccggcagtgggtggacacggacgagatcagcagcgagaatatc
gtcatccccccggaaacatacgtcaaggtggctggtcacctccgctccttccagaacaga
aaaagcttggtggcgttcaagatcatccctctggaggatatgaatgagctcaccactcac
atcctggaaaccgtcaacgcccaccaaacgctcagcaagcccagcggcccgctcatcatg
ggcaactctgtcggtgcctcagggatgggcgacatggggagcctgggcgggagcggcagc
ggaccgaccaacgggctcaccctgcaccagagccaggtgctgaatctgatcaaagcctat
cccaagccagaggggctcagcttccaggagctcaggtctcagctgccaaacctgaacgca
tcagtcatcaagtga

DBGET integrated database retrieval system