KEGG   Ornithorhynchus anatinus (platypus): 100089458Help
Entry
100089458         CDS       T01045                                 

Definition
histone deacetylase 11-like
Orthology
K11418  
histone deacetylase 11 [EC:3.5.1.98]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Alcoholism
Viral carcinogenesis
Class
Human Diseases; Cancers; Viral carcinogenesis [PATH:oaa05203]
Human Diseases; Substance dependence; Alcoholism [PATH:oaa05034]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 172 aa AA seqDB search
GNGHERDFMYDNRVYIMDVYNRYIYPGDGFAKRAIKRKIELDWGTEDKEYLQKVEMHVAG
ALNELRPDVVIYNAGTDILDGDPLGGLAISPQGIVKRDEIVFRAARTHRVPILMVTSGGY
QKRTARIIADSILNLHSLGLIDKNLATGEAKSSEVELMLRTTPLLEATQLPV
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
ggaaatggccacgagagagacttcatgtatgataatcgagtgtatattatggacgtctac
aatagatacatttatccaggggatgggtttgctaaacgagccataaagcggaagattgaa
ctggactgggggacggaagacaaagaatatctccagaaggtagagatgcacgtggcggga
gcactgaatgaactgaggccagatgttgttatttataatgcaggaaccgacattctggat
ggggatccactcggaggcctcgccatctccccccagggcattgtgaaaagagatgagatc
gtgttccgagctgcccgcacccaccgtgttcccatcttgatggtgacctccggaggttat
cagaagaggacagctcggatcattgccgactccatcctgaatctccatagcttggggctc
attgacaagaatcttgcaaccggcgaagccaaaagctccgaggtagaactgatgctcaga
actacacccctgttggaagcgactcagctgccagtgtag

DBGET integrated database retrieval system