KEGG   Ornithorhynchus anatinus (platypus): 100089749Help
Entry
100089749         CDS       T01045                                 

Definition
intestinal-type alkaline phosphatase 1-like
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    100089749
Enzymes [BR:oaa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     100089749
Exosome [BR:oaa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100089749
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 271 aa AA seqDB search
MTQPVAHPFLFLLLPLLLLLGLWAPITGGVIPEEEENPEFWNRKALNALEAAKKLQPINT
RAKNLILFLGDGMGVSTVSAARILNGQLKNKTGPETPLTMDLFPYLALSKTYNVDRQVPD
SAGTATAYLCGVKANYKTIGVSAKARYNDCQTKHGNEVYSVLYRAKKAGKSVGVVTTTRV
QHASPSGNYAHVVNRDWYSDTNMQPEDLKSGCKDIAFQLISNMDIDVILGGGRKYMFPKG
TPDPEYPNNVSQEGIRGDGKDLVKQWLNEHK
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagccggtagcccaccccttcctcttcctcctgctgcctctgctgttgctgctg
ggcctctgggcccccatcacgggcggcgtcatcccagaggaggaagagaaccctgaattc
tggaaccgcaaagctctcaatgccctggaagccgccaaaaagttgcagcccatcaacact
agagccaagaatctcattcttttcctgggagatgggatgggggtgtccaccgtgtcagcc
gcccggatactgaacggccaactgaaaaacaaaaccggacccgaaacgcccctgacgatg
gacctctttccctacctcgctctgtccaagacgtacaacgtggacaggcaggtgccggac
agtgcgggcacagccaccgcttacctgtgtggggtgaaggccaactacaagaccatcggg
gtcagcgccaaagcccgctataacgactgccaaacaaagcatggaaatgaggtctactcc
gtcctgtaccgggccaagaaggctgggaagtcggtgggggtggtaacaaccacccgtgtg
cagcatgcctcaccctcgggcaactacgcccacgtggtcaaccgtgactggtactcggac
accaatatgcagcctgaagacttaaagtcgggctgcaaggatatcgcctttcagctcatc
tccaacatggacatcgacgtgatcctgggagggggccgcaaatacatgttcccaaaaggt
acaccagaccccgaatacccgaacaacgtctcccaggaggggatccggggcgacggcaag
gacctggtgaagcagtggctgaacgagcacaag

DBGET integrated database retrieval system