KEGG   Ornithorhynchus anatinus (platypus): 100089749Help
Entry
100089749         CDS       T01045                                 

Definition
intestinal-type alkaline phosphatase 1-like
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:oaa00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 271 aa AA seqDB search
MTQPVAHPFLFLLLPLLLLLGLWAPITGGVIPEEEENPEFWNRKALNALEAAKKLQPINT
RAKNLILFLGDGMGVSTVSAARILNGQLKNKTGPETPLTMDLFPYLALSKTYNVDRQVPD
SAGTATAYLCGVKANYKTIGVSAKARYNDCQTKHGNEVYSVLYRAKKAGKSVGVVTTTRV
QHASPSGNYAHVVNRDWYSDTNMQPEDLKSGCKDIAFQLISNMDIDVILGGGRKYMFPKG
TPDPEYPNNVSQEGIRGDGKDLVKQWLNEHK
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagccggtagcccaccccttcctcttcctcctgctgcctctgctgttgctgctg
ggcctctgggcccccatcacgggcggcgtcatcccagaggaggaagagaaccctgaattc
tggaaccgcaaagctctcaatgccctggaagccgccaaaaagttgcagcccatcaacact
agagccaagaatctcattcttttcctgggagatgggatgggggtgtccaccgtgtcagcc
gcccggatactgaacggccaactgaaaaacaaaaccggacccgaaacgcccctgacgatg
gacctctttccctacctcgctctgtccaagacgtacaacgtggacaggcaggtgccggac
agtgcgggcacagccaccgcttacctgtgtggggtgaaggccaactacaagaccatcggg
gtcagcgccaaagcccgctataacgactgccaaacaaagcatggaaatgaggtctactcc
gtcctgtaccgggccaagaaggctgggaagtcggtgggggtggtaacaaccacccgtgtg
cagcatgcctcaccctcgggcaactacgcccacgtggtcaaccgtgactggtactcggac
accaatatgcagcctgaagacttaaagtcgggctgcaaggatatcgcctttcagctcatc
tccaacatggacatcgacgtgatcctgggagggggccgcaaatacatgttcccaaaaggt
acaccagaccccgaatacccgaacaacgtctcccaggaggggatccggggcgacggcaag
gacctggtgaagcagtggctgaacgagcacaag

DBGET integrated database retrieval system