KEGG   Ornithorhynchus anatinus (platypus): 100090009Help
Entry
100090009         CDS       T01045                                 

Gene name
USP14
Definition
ubiquitin specific peptidase 14 (tRNA-guanine transglycosylase)
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.1.2.15]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 431 aa AA seqDB search
LKQGMTLLMMGSADALPEEPVARTVFVEDMTEEQLASAMELPCGLTNLGNTCYMNATVQC
IRSVPELKEALKRYAGALRASGEMASAQYITAALRDLFDSMDKSSSSIPPIILLQFLHMA
FPQFAEKGDQGQYLQQDANECWVHVMRVLQQKLEALEGDSDMETDSGSTAAAPPKKKSLI
DQFFSVEFETTMKCTEAEEEEATKGKENQLQLSCFINQEVKYLFTGLKLRLQEEITKQSP
TLQRNALYIKSSKISRLPAYLTIQMVRFFYKEKGSVNAKVLKDVKFPLMLDVYELCTPEL
QEKMVSFRSKFKDLEDKKVNQQPKKTNKGSGTQKEVKYEPFSFPDDIGSNNCGYYDLQAV
LTHQGRSSSSGHYVSWVKRKQEEWIKFDDDKVSIVTPDDILRLSGGGDWHIAYVLLYGPR
KVEIIEEEAEQ
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
ctcaaacagggaatgactcttctgatgatgggttcagccgacgctcttcccgaggagcct
gtggctaggaccgtcttcgtagaagacatgacagaagaacagctagcctctgctatggaa
cttccttgtggactgaccaacctcggtaacacttgttatatgaatgctacagttcagtgt
atccgctcggtaccagaactcaaagaggcccttaagaggtatgctggtgctttaagagct
tctggggaaatggcttcagcacaatatattactgcagctcttagagatttgtttgattcc
atggataaaagttcctccagcatccctccgattattcttctgcagtttttacacatggcc
tttcctcagtttgcagagaagggtgatcaaggacagtatcttcaacaggatgccaatgaa
tgttgggtccacgtgatgagagtactgcaacaaaaactggaagctttagaaggtgactct
gatatggagacagattctggatcaacagcagcagcacctcctaaaaagaagagtttgatt
gatcagttcttcagtgttgaatttgaaacaaccatgaaatgtacagaagctgaagaagaa
gaagccactaaaggaaaggaaaatcagcttcaactcagctgcttcatcaatcaagaagtc
aagtatctttttacaggacttaaactgcgacttcaggaagaaatcaccaaacagtctcca
acgttgcaaagaaatgctctgtacatcaaatcgtcaaagatcagccggctgcctgcttac
ctgactattcagatggttcgatttttttacaaagaaaagggatctgtgaatgccaaagtt
ctcaaggatgttaaatttcctctcatgttggatgtttatgagctctgtaccccagaactt
caagagaaaatggtctcctttcgatcaaaattcaaggatctagaagacaagaaagtaaat
caacagccaaagaaaacaaacaaaggtagcggtacccagaaagaagttaaatatgagccc
ttttcttttcctgatgatattggttccaataattgtggttactacgacttgcaagcggtg
ctaacgcatcagggaaggtctagttcctcaggccattatgtatcatgggtgaaaaggaaa
caagaagagtggattaagtttgatgatgacaaagtcagcattgttactccagatgatatt
ttgcgattatccggtggtggagactggcatatagcttatgttctactctacgggccccgc
aaagttgagatcattgaagaggaagcggaacaataa

DBGET integrated database retrieval system