KEGG   Ornithorhynchus anatinus (platypus): 100090031Help
Entry
100090031         CDS       T01045                                 

Gene name
GPX7
Definition
glutathione peroxidase 7
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    100090031 (GPX7)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    100090031 (GPX7)
 Organismal Systems
  Endocrine system
   04918 Thyroid hormone synthesis
    100090031 (GPX7)
Enzymes [BR:oaa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     100090031 (GPX7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 144 aa AA seqDB search
MGMVSLVVNVASECGFTDQHYRALQQLQKDLGPSHFNVLAFPCNQFGQQEPDGNKEIESF
VRKTYGVSFPMFSKIAVSGAGANAAFKFLTESSGEEPTWNFWKYLVSPDGKVVNSWDSTV
PVEEIKPHITALLRRMIMKKKDEL
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgggtatggtgtctctggtggtcaacgtggcaagcgagtgcggtttcaccgatcagcac
taccgcgccctccagcagttgcagaaggaccttggcccgtcccacttcaacgtgctcgcc
ttcccttgcaaccagttcggccagcaggagccagacggtaacaaggagatcgagagcttt
gtccggaagacctacggcgtctcctttcccatgttcagcaaaattgctgtcagtggggcc
ggggcgaacgccgccttcaagttcttaacagaatcttccggggaggagccgacctggaac
ttctggaagtacctggtgtccccagatgggaaagtggtgaacagctgggattccaccgtc
cctgtggaggagatcaaaccccacatcacagccctcttgagaagaatgatcatgaagaag
aaagacgagttgtga

DBGET integrated database retrieval system