KEGG   Ornithorhynchus anatinus (platypus): 100090093Help
Entry
100090093         CDS       T01045                                 

Gene name
LYZL6
Definition
lysozyme-like 6
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Brite
Enzymes [BR:oaa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     100090093 (LYZL6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 162 aa AA seqDB search
MGVLDPESQTLASAQLRRTLVVLLLASSLLGEAQSEILARCELAMQLQEGGLGGFKGYSL
ADWICLAYQESKFDTMLISTNSDGSTDYGLFQINSHVWCSDHLSHSQNRCKVSCIEILNN
IVAHILCAKKIVSEHSGLKYWSSWTEHCEGRDLSHWVAGCDL
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgggggtcctggatccagaaagccagaccctggcctctgcccagcttaggaggaccttg
gtggtcctcctgttggccagcagcctcttgggggaggcccagagtgagatccttgcccgc
tgtgagctggccatgcagcttcaagaaggaggcctgggggggtttaagggctacagcctc
gctgactggatatgcctggcctaccaggagagcaagtttgacacgatgctgatcagcacc
aactcagatggcagcacggactatggcctcttccagatcaacagccacgtctggtgctct
gaccacctcagccattcgcagaaccgctgcaaggtctcctgcatcgagatactgaataac
atcgttgcccacatcctctgtgccaagaagattgtgtctgagcactctgggctcaaatac
tggtcttcctggacggagcactgtgagggccgggacctctcccactgggtggccggatgt
gacctgtga

DBGET integrated database retrieval system