KEGG   Ornithorhynchus anatinus (platypus): 100090165Help
Entry
100090165         CDS       T01045                                 

Gene name
RPTOR
Definition
regulatory-associated protein of mTOR
Orthology
K07204  
regulatory associated protein of mTOR
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Insulin signaling pathway
MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100090165 (RPTOR)
   04152 AMPK signaling pathway
    100090165 (RPTOR)
   04150 mTOR signaling pathway
    100090165 (RPTOR)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100090165 (RPTOR)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    100090165 (RPTOR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 387 aa AA seqDB search
MKVLNSIAYKATVNTRPQRILDTSPLTQSAPASPTNKGLHIHQVGGSPPTPSTSSSSLTN
DMTKQPIARDIASGRPANVGSIGVQYTPHSHQFPRTRKMFDKGPDQTTDDPDDTVGHKSF
ISATMQTGFCDWSAKYFAQPVMKIPEEHDLESQIRKEREWRFLRNTRVRKQAQQIIQKGI
TRLDDQIFLNRNPGVPSVVKFHPFTPCIAVADKDSICFWDWEKGEKLDYFHNGNPRYTRV
TAMEYLNGQDCSLLLTATDDGAIRVWKNFADLEKNPEMVTAWQGLSDMLPTTRGLARKVS
IYLDRSKQGGAGMVVDWEQETGLLMTSGDVRIIRIWDTDREMKVQDIPTGADSCVTSLSC
DSHRSLIVAGLGDGSIRVYDRRMALSE
NT seq 1163 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtgctcaacagcatcgcctacaaggccacagttaatacccgaccccaacgcatt
ctggacacgtcacctctcacccagtccgccccagccagccctaccaacaagggcttacac
attcaccaagtaggagggtcccctcccactcccagcacgagcagctccagcctcaccaac
gacatgaccaaacagcccatcgcccgggacatcgcttcgggccgaccggccaacgtgggc
agcatcggggtgcagtacaccccccactcccaccagttcccccggacacggaaaatgttt
gacaagggccccgaccagaccacggacgacccagacgacaccgtgggacacaagagtttc
atctcggccacgatgcagacgggtttctgtgattggagcgccaaatatttcgcccagcca
gtcatgaagattccggaagagcacgatttggagagccagatccgcaaggagcgggagtgg
cgctttctccggaacacgcgggtcaggaagcaagcacagcagatcatccagaaagggatc
acaaggcttgatgatcagatcttcctgaacaggaatcctggggtcccctctgtggtcaaa
ttccaccctttcaccccgtgcatagccgtagccgataaagacagcatttgtttttgggac
tgggaaaagggagagaagctggattatttccacaacggaaatccccgctacacgagggtc
acggccatggaatacctgaacgggcaggactgctcgctcctgctgaccgccacagacgat
ggggccatccgggtgtggaagaacttcgccgacctggagaagaacccggagatggtgacg
gcctggcagggattgtccgacatgctgcccacgacacgaggtctggcccgaaaggtctca
atctatcttgaccgaagtaagcagggaggagccgggatggtggtggactgggaacaggag
accgggctcctcatgacctcgggagacgttcggatcatccgcatctgggacacggatcgg
gagatgaaagtgcaggacatccccacgggagctgacagctgcgtgaccagcctgtcctgt
gactctcaccgctcgctcatcgtggccgggctgggtgacggctccatcagagtctacgac
cggaggatggctctcagcgaatg

DBGET integrated database retrieval system