KEGG   Ornithorhynchus anatinus (platypus): 100090165Help
Entry
100090165         CDS       T01045                                 

Gene name
RPTOR
Definition
(RefSeq) regulatory-associated protein of mTOR
Organism
oaa  Ornithorhynchus anatinus (platypus)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 430 aa AA seqDB search
PIPSDSVCFHSSPGVSFNSVYTQIWRVLLHLAADPYPDVSDLAMKVLNSIAYKATVNTRP
QRILDTSPLTQSAPASPTNKGLHIHQVGGSPPTPSTSSSSLTNDMTKQPIARDIASGRPA
NVGSIGVQYTPHSHQFPRTRKMFDKGPDQTTDDPDDTVGHKSFISATMQTGFCDWSAKYF
AQPVMKIPEEHDLESQIRKEREWRFLRNTRVRKQAQQIIQKGITRLDDQIFLNRNPGVPS
VVKFHPFTPCIAVADKDSICFWDWEKGEKLDYFHNGNPRYTRVTAMEYLNGQDCSLLLTA
TDDGAIRVWKNFADLEKNPEMVTAWQGLSDMLPTTRGLARKVSIYLDRSKQGGAGMVVDW
EQETGLLMTSGDVRIIRIWDTDREMKVQDIPTGADSCVTSLSCDSHRSLIVAGLGDGSIR
VYDRRMALSE
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
tcccataccctctgattctgtttgttttcattcctccccaggggtgtctttcaacagtgt
ttacacccaaatctggagagtcctcctccacctggccgccgacccctatcccgacgtctc
cgatttggccatgaaagtgctcaacagcatcgcctacaaggccacagttaatacccgacc
ccaacgcattctggacacgtcacctctcacccagtccgccccagccagccctaccaacaa
gggcttacacattcaccaagtaggagggtcccctcccactcccagcacgagcagctccag
cctcaccaacgacatgaccaaacagcccatcgcccgggacatcgcttcgggccgaccggc
caacgtgggcagcatcggggtgcagtacaccccccactcccaccagttcccccggacacg
gaaaatgtttgacaagggccccgaccagaccacggacgacccagacgacaccgtgggaca
caagagtttcatctcggccacgatgcagacgggtttctgtgattggagcgccaaatattt
cgcccagccagtcatgaagattccggaagagcacgatttggagagccagatccgcaagga
gcgggagtggcgctttctccggaacacgcgggtcaggaagcaagcacagcagatcatcca
gaaagggatcacaaggcttgatgatcagatcttcctgaacaggaatcctggggtcccctc
tgtggtcaaattccaccctttcaccccgtgcatagccgtagccgataaagacagcatttg
tttttgggactgggaaaagggagagaagctggattatttccacaacggaaatccccgcta
cacgagggtcacggccatggaatacctgaacgggcaggactgctcgctcctgctgaccgc
cacagacgatggggccatccgggtgtggaagaacttcgccgacctggagaagaacccgga
gatggtgacggcctggcagggattgtccgacatgctgcccacgacacgaggtctggcccg
aaaggtctcaatctatcttgaccgaagtaagcagggaggagccgggatggtggtggactg
ggaacaggagaccgggctcctcatgacctcgggagacgttcggatcatccgcatctggga
cacggatcgggagatgaaagtgcaggacatccccacgggagctgacagctgcgtgaccag
cctgtcctgtgactctcaccgctcgctcatcgtggccgggctgggtgacggctccatcag
agtctacgaccggaggatggctctcagcgaatg

DBGET integrated database retrieval system