KEGG   Ornithorhynchus anatinus (platypus): 100090226Help
Entry
100090226         CDS       T01045                                 

Definition
josephin-1-like
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 225 aa AA seqDB search
MAFSQEVYFSRVAGGLLRRTTRRKDFHSPRIKLQFQISGKSKSKPLLSSEKVKELLNYPS
CAVTSCYKGTGSAQRQSPKLELSCRLSPSTMVTPHNNSMLGNGNYDVNVIMAALQTKGYE
AVWWDKRRDVNVIALSNVTGFIMNLPSSLCWGPLKLPLKRQHWICVREVGGAYYNLDSKL
KLPEWIGGETELRKFLNHQLRGKNCELLLVVPEEVEAQQSWRADV
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggcgttttctcaagaggtgtatttttccagagttgcaggaggcctccttagaagaact
acaagaaggaaagacttccactcccccagaataaagcttcaatttcaaatttctggaaaa
tccaagtctaagcccttactttccagtgaaaaagtaaaagagctgctgaattatccctcc
tgcgctgttacttcctgctacaaagggacgggaagtgcccaaaggcaatcaccaaaactt
gaattaagttgcaggctgtctccgagcaccatggtgaccccccacaacaatagcatgctg
gggaacgggaactatgacgtgaacgtcatcatggcggcacttcagaccaaaggctatgag
gcggtctggtgggacaaacgcagggatgtcaacgtcatcgccctctcgaacgtcacgggc
ttcatcatgaacctgccgtccagcctgtgctggggcccgctgaagctccccctcaaaagg
cagcactggatctgcgtccgcgaggtgggaggcgcttactacaacctcgactctaaactc
aagcttcctgagtggatcggaggcgagaccgagctcaggaaatttttgaatcaccagctg
cgaggaaagaactgtgaactgctgctggtggtgccggaagaggtggaggcccagcagagc
tggagggctgacgtgtga

DBGET integrated database retrieval system