KEGG   Ornithorhynchus anatinus (platypus): 100090421Help
Entry
100090421         CDS       T01045                                 

Gene name
RASGRP2
Definition
(RefSeq) RAS guanyl releasing protein 2
  KO
K12361  
RAS guanyl-releasing protein 2
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Chemokine signaling pathway
Platelet activation
Pathways in cancer
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100090421 (RASGRP2)
   04015 Rap1 signaling pathway
    100090421 (RASGRP2)
   04010 MAPK signaling pathway
    100090421 (RASGRP2)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100090421 (RASGRP2)
   04062 Chemokine signaling pathway
    100090421 (RASGRP2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100090421 (RASGRP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 450 aa AA seqDB search
MSLLFDHLEPTELAEHLTFLEYRSFCKILFQDYHSFVTHGCTVDNPILERFISLFNSVSQ
WVQLMVLSKPTAQQRALVITHFIHVAEKLLQLQNFNTLMAVVGGLSHSSISRLKETHSFV
SSETVKLWESLTELVTATGNYGNYRRRLAACVGFRFPILGVHLKDLVALQLALPDWLDPA
HTLLNGAKMRQLFSILEELAMVTSLRPPVQANPDLLSLLTVSLDQYQTEDELYQLSLQRE
PRSKTSPTSPTACSLPPRPPVLEEWTAAAKPKLDQALVVEHIEKMVESVFRNFDVDGDGH
ISQEEFQIIRGNFPYLSTFRDLDQNKXGQEAGMGAGWQGERGRRDSDFDREVKCSHCKNL
ILGIYKQGLKCRACGVNCHKQCREQLSVECRRRAQSMSLEQPVSSPSHTHTHLRAFSFSL
PRPGKRGSRPPEIREEEVQDVEDGVFDIHL
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgtctctgctcttcgatcacctggagcccacagagctggccgaacatctcaccttcttg
gagtaccgctccttctgcaagatcctgttccaggactatcacagcttcgtgacgcacggc
tgcacggtggacaaccccatcctggagcgtttcatctccctcttcaacagcgtttctcag
tgggtgcagctcatggtgctcagcaagcccaccgcccagcagagggcgctggtcatcacc
cacttcatccacgtggcagagaagctgctgcagctgcagaacttcaacacgttgatggcc
gtggttgggggcttgagtcacagctccatttcccgcctcaaggagacgcacagcttcgtc
agctcggagaccgtcaagctctgggaaagtctgacggagctggtgacggccacgggcaat
tacggcaactaccggcggcggctggcggcctgcgtgggcttccgcttccccatcctgggc
gtccacctcaaggacctggtggcgctgcagctggcactgcccgactggctggaccccgcc
cacaccctgctcaacggcgccaagatgcgccagctcttcagcatcctggaggagctggcc
atggtgaccagcctgcggccccccgtgcaggccaacccggacctgctcagcctgttgacg
gtgtctctggatcagtaccagacagaggatgagctgtaccagctttccctacagcgagag
ccccgctccaaaacctcgccgaccagccccaccgcctgctccctgccgcctcgcccgccc
gtgctggaggagtggactgcggccgccaagcccaaactggaccaggccctggtggtggag
cacattgagaagatggtggagtctgtgttccggaatttcgacgtggacggcgatgggcac
atctcgcaggaggaattccagatcatccggggaaactttccctacctcagcaccttcagg
gatctcgaccagaacaagtgaggccaggaagcgggcatgggagcaggatggcaaggggaa
aggggaaggagggactctgattttgacagggaggtgaagtgttcccattgcaagaacttg
atcctgggcatctacaaacaggggctcaagtgccgagcctgtggcgtgaactgccacaag
cagtgccgggagcagctgtccgtggaatgccgtcgacgggcccagagcatgagcctggag
caacccgtttcttccccgtcccacacgcacacccacctccgcgcctttagcttttccctc
cccaggcccgggaagcgtggctcccggccaccagagatccgggaggaggaggtccaggac
gtggaagacggggtgtttgatattcacttgtaa

DBGET integrated database retrieval system