KEGG   Ornithorhynchus anatinus (platypus): 100090460Help
Entry
100090460         CDS       T01045                                 

Definition
protein unc-13 homolog B-like
Orthology
K15293  
protein unc-13
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Synaptic vesicle cycle
Class
Organismal Systems; Nervous system; Synaptic vesicle cycle [PATH:oaa04721]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1247 aa AA seqDB search
MTAAGPCERSDQKRPAMLDTGRNVISYVPFSWKYIPEEEARYWTKKLQINDLEGPEYSFN
EEVQKTPLPIAASQCCNWSYFGWGEQQTFEDPDSAGEDRDSDYRSETSIPPPHRTASRPK
APARQFPGPACLLQQQQQQLQGGSRDSCNDSMQSYDLDYRERRALSPTGSSRYGSSCNVS
QASSQLSEPEQFQDNGPSSEQEDDLRDKKPTDSHRSSGSYSRDGLVGYREEQEKPSGVAG
GTEQKRAYEKREKVSEGTTVKVPPELEQPRALPTRSQESYPAENEPSPFTPARAHWIRAV
TKVRLQLHEVPDDGDPSKQPWLQGGPANGLYGIDSMPDLRKRKPLPLVSDLCLVQSRKAG
VTSAMATRTSLKDEDLKSHVYKKTLQALIYPISCTTPHNFEVWTATTPTYCYECEGLLWG
IARQGMRCSECGVKCHEKCQDLLNADCLQRAAEKSSKHGAEDRTQNIIMAMKDRMKIRER
NKPEIFDVIRDVFTVGKVAHAQQMKTVKQSVLDGTSKWSAKITITVVCAQGLQAKDKTGS
SDPYVTVQVGKTKKRTKTIFGNLNPVWEEKFHFECHNSSDRIKVRVWDEDDDIKSRVKQR
LKRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYH
VESTXLPQNLFHHLTDIQGNGGVKIPEAKGDDAWKVYFDETAQEIVDEFAMRYGIESIYQ
AMTASXXXXTSMLYNDHTTASTNVSASDRFAASNFGKERFVKLLDQLHNSLRIDLSMYRN
NFPASSPERLQDLKSTVDLLTSITFFRMKTKKQDLPPEDQGPSIKNLDFWPQLITLVVSI
IEEDRNSYTPVLNQFPQELSVGKISAEVMWGLFAQDMKYAMEEHERHRVDVRSADYMNLH
FKVKWLYNEYVHELPSAQTRVPDYPTWFEQFVMQWLEENEEVALEFLHGALERDKKDGFQ
QTSEHALFSCSVVDVFTQLNQSFEIIKKLECPDPAIVSRYMRRFAKTIGKVLIQYADILT
ATFQSYCSKEKLPCILMNNIQQLRVQLEKMFEAMGAKELDAEAGDNLKELQVKLNTVLDE
LSTVFGNSFQARIDECVRQMADILGQVKGTGNVAAGSRNTVAQDADNVLRPLMDFLDGNL
TLFAAVCEKTVLKRVLKELWRVVMDTMEKMIVLPPLSDQTVRPTSYPVTPPDPLRPPPPS
PPGHFPFGRGCPRPPRRAGEDERPGEAELVPGAVLDRARKGGGSRGL
NT seq 3744 nt NT seq  +upstreamnt  +downstreamnt
atgaccgctgctggcccttgcgaaagatcggaccagaagaggcctgcgatgctggacacg
ggacgtaatgtgatctcgtacgtgccgttttcgtggaagtatatcccagaggaggaagcc
agatattggaccaaaaaactgcagatcaatgatttggaagggcccgagtattcctttaat
gaagaggtccagaagacaccactgcccattgccgcttcccagtgttgtaattggagctat
ttcggatggggagagcagcagacctttgaagaccccgacagtgcaggggaagaccgagac
agtgactaccgcagcgagaccagcatccctcctccgcaccgcaccgcctcccggcccaaa
gccccggcgcgccagttccctgggcccgcctgcctgctgcagcagcaacagcagcagctg
cagggtggctcccgggactcctgcaacgactccatgcaaagctatgaccttgactatcgg
gaacggagggccctcagtcccacgggcagcagtaggtacggctcttcctgtaacgtgagc
caggccagctctcagctgagcgagccggagcagttccaggacaacggccccagctcggag
caggaagacgacctccgggacaagaagccgaccgactcccaccgcagctcgggaagctac
tcccgggatggtctggtgggatacagagaggagcaggaaaaaccctcaggagtggccggt
ggaaccgaacagaagagagcctatgaaaagcgagagaaggtcagcgaaggcaccaccgtc
aaagttcctccagagctagaacagcccagggcgctccctacgaggtctcaagaaagttat
cctgctgagaatgagccttccccattcactccagccagagctcactggatccgagccgtt
accaaagtccggctccagctgcatgaggtccccgatgacggtgacccatcgaagcagccg
tggctccagggcgggccggccaacggtctctatggcatcgacagcatgcctgatcttcgc
aaaaggaaaccacttccactggtcagcgacctgtgcctggtccagtcgcgaaaggctggc
gtcacctctgccatggctacgcgcacttctctcaaggacgaagacctgaaatcccacgtg
tacaagaagactctacaagccctgatctaccccatctcctgcaccacaccccacaacttc
gaagtgtggacggccaccacccccacctactgctacgagtgcgagggactcctttggggc
atcgcccgccaaggcatgcgctgttccgaatgtggcgttaagtgccacgagaagtgccag
gacctgctcaacgccgactgcctccaacgagcggcagagaagagctctaagcacggggcc
gaggaccggacccagaacatcatcatggccatgaaggatcgcatgaagatccgggagcgg
aataagccagagatcttcgacgtgatccgtgacgtattcaccgtgggcaaggtggcccac
gcccagcagatgaagacggtgaagcagagtgtgctagatggtacctccaaatggtcagca
aagatcaccatcacggtggtatgtgctcaaggcctgcaggccaaagacaaaaccggctcc
agcgacccatacgtcaccgtccaagtcggaaaaaccaagaaaaggacaaagaccattttt
ggaaacctgaatccagtttgggaagagaagtttcatttcgagtgccataactcctccgac
cggatcaaggtgcgggtctgggacgaggacgacgacatcaagtcgcgggtgaagcagagg
ctgaagcgcgagtcggacgacttcctggggcagaccatcatcgaggtgcggacgctgagc
ggggagatggacgtctggtacaatcttgagaagagaacagataaatcggctgtctcggga
gccatccggttgcagatcagcgtggagatcaagggggaggagaaggtggcaccgtatcac
gtcgaatccaccnacctccctcagaacctcttccaccacctcacggacatccagggcaac
ggcggggtcaagattccggaggccaaaggagatgacgcgtggaaagtgtattttgatgaa
acggcccaggagatcgtcgatgagtttgccatgcgctacggcatcgagtccatctaccag
gccatgacggcgagtannnnnnnnnnaacatcaatgctttataatgaccacactaccgcc
tccaccaacgtctctgcctccgaccgctttgccgcctccaactttggtaaggagagattt
gtgaaactgctggaccagctgcacaactccttacgcattgacctctccatgtaccggaac
aactttccagccagcagcccagagaggctgcaggatctgaagtccaccgtagatctgctg
accagcatcacttttttcaggatgaagactaaaaagcaggatctgccaccagaggaccaa
ggccccagcatcaaaaacctggatttctggccccagctcattaccttggtcgtgtctatc
atcgaggaggacaggaattcgtacacccccgtcctgaaccaattcccacaggagctgagt
gtggggaagatcagcgcggaggtcatgtggggcctctttgcgcaggacatgaaatacgcc
atggaagagcacgagaggcaccgggttgatgttcggagcgctgactacatgaacctgcac
ttcaaggtcaagtggctgtacaacgagtacgtgcacgaactgccctcggcccagacccgc
gtgcctgactatcccacgtggtttgagcagtttgtgatgcagtggctggaggagaatgag
gaggtggccctggagttcctgcatggcgcgctggagagagacaagaaggatgggttccag
cagacgtccgagcacgccctcttctcctgctcggtggtggacgtcttcactcagctcaac
cagagctttgagatcatcaagaagctggagtgtcccgacccagccatcgtctcccgttac
atgaggcgatttgccaagaccatcgggaaggtgctgattcagtatgcggatatcctgacg
gcgacattccagtcctactgctccaaggagaagctgccctgcatcctgatgaacaatatc
caacaactgcgggtgcagctcgagaagatgtttgaggccatgggggcgaaggagctggac
gctgaggcgggagacaacctcaaagagctgcaggtgaagctcaacacggttctggatgaa
ctcagcacggtgtttgggaacagcttccaggcccggattgacgaatgcgtccgacagatg
gctgacatcttgggccaggtcaaggggacggggaacgttgccgccggttctaggaacacg
gtcgctcaagatgcggacaacgtgctgcgaccgctcatggacttcttggacggcaatctc
actctcttcgccgccgtgtgtgagaagacggtgctgaagcgcgtcctgaaggagctgtgg
cgtgtggtgatggacaccatggagaagatgattgttctgcctcccctctctgaccagacg
gtgcgaccgacctcttaccccgtgacccctcccgatcccctccgccctcctcccccctcc
cctcccggacacttcccgttcggccgcggctgcccccggcccccgcggcgggccggagaa
gatgagaggcccggagaagctgagctcgtccccggggcggtcctggaccgagccagaaaa
ggcggcgggagccggggtctctga

DBGET integrated database retrieval system