KEGG   Ornithorhynchus anatinus (platypus): 100090554Help
Entry
100090554         CDS       T01045                                 

Gene name
USP15
Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 15
  KO
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.4.19.12]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Brite
Enzymes [BR:oaa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100090554 (USP15)
Peptidases [BR:oaa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100090554 (USP15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 408 aa AA seqDB search
YKVVVPKIGNILDLCTALSTLSGVAADKMIVTDIYNHRFHRIFAMDENLSSIMERDDIYV
FEITLNRTEDTDQVIIPVCLREKFRHTGYSHHSGSSLFGQPFLMAVPRNNTEDKLYNLLL
LRMCRYVKTSTESEESEGSLHCCKDHGINGNGPNGIHEEGSPKLVETTNPDDESSQDQEL
PSENENSQSEDSVGGDNDSENGLSTEETCKGQLLTGHKKRLFTFQFNNLGNTDINYIKDD
TRHIRFDDRQLRLDERSFLALDWDPELKKRYFDDNAAEDFEKHESVEYKPPKKPFVKLKD
CIELFTTKEKLGAEDPWYCPNCKEHQQATKKLDLWSLPPVLVVHLKRFSYSRYMRDKLDT
LVDFPITDLDMSEFLINPNAGPCRYNLIAVSNHYGGMGGGHCKFILPT
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
tacaaagtagtagtccccaaaattggaaatatactagatctttgcacagcactatccact
ttgtctggggtcgctgcagataagatgatagttacagatatatacaaccacaggtttcac
cggatatttgccatggatgaaaacctcagtagtattatggaacgagatgatatttatgtg
tttgaaatcaccctcaacagaacagaggatacagaccaagtcatcattccggtttgctta
agggaaaagttcaggcacacgggctacagccatcacagcggctcttcactgtttgggcag
cctttccttatggcagtgcccagaaacaacactgaagataaactctacaatcttctgctc
ttgaggatgtgccgctatgtgaaaacgtcgaccgaaagcgaagaatcggaaggatcgctc
cactgctgtaaggaccacggtatcaacggcaatggccccaatggcatccatgaggaaggc
tccccgaaattggtagaaacaacgaacccagatgatgaatccagtcaggatcaagaactc
ccctcagaaaacgaaaatagtcaatcagaagattcggtcggaggagataatgattctgag
aatggattaagtactgaggagacttgtaaaggtcaacttctcacgggacacaaaaagcga
ctgtttacattccagttcaacaacttaggcaatacagacatcaactacatcaaagatgat
accaggcatattagatttgatgatcgacagctcaggctagatgaaagatcttttcttgct
ttggattgggatcctgaattgaaaaaaagatattttgatgataatgcagctgaggatttt
gaaaaacatgaaagcgtggaatataaacctccgaaaaaaccctttgtgaaattaaaagat
tgcattgaacttttcaccacgaaagaaaaactaggtgctgaagatccctggtactgtcca
aactgtaaagagcatcagcaagctacgaaaaaattagatctgtggtctctgcctccggtg
ctagtggtccatctaaagcgtttttcttacagcagatacatgagggacaaattggacacc
ttagtcgattttcctattactgatttggacatgtccgaattccttattaatccaaatgca
gggccctgccgctacaatttgatcgctgtgtccaaccactatggagggatgggaggagga
cactgtaagttcattttgcctacgtga

DBGET integrated database retrieval system