KEGG   Ornithorhynchus anatinus (platypus): 100090822Help
Entry
100090822         CDS       T01045                                 

Definition
muscarinic acetylcholine receptor M4-like
Orthology
K04132  
muscarinic acetylcholine receptor M4
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Neuroactive ligand-receptor interaction
Cholinergic synapse
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100090822
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100090822
 Organismal Systems
  Nervous system
   04725 Cholinergic synapse
    100090822
G protein-coupled receptors [BR:oaa04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Acetylcholine (muscarinic) [Table]
    100090822
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 325 aa AA seqDB search
MQSTHRPVFSPSVSPSPSLCRPDLRLRARTSPRRGSKMANSTPVNGSHGNQSMEPLSHNR
YEMVEMVFIATVTGSLSLVTVVGNILVMVSIKVNRQLQTVNNYFLFSLACADLIIGAFSM
NLYTVYIIKGYWPLGTVVCDLWLALDYVVSNASVMNLLIISFDRYFCVTKPLTYPARRTT
KMAGLMIAAAWVLSFVLWAPAILFWQFLVGKRTVPADQCFIQFLSNPAATFGTAIAAFYL
PVVIMTVLYIHISLASRSRVRKHRPEGDKEKKAKSLSFLRSPLIKQNNNNPPKKPALVAA
EAGAGGRAIFKKLTLNRATLSSIVA
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagcacccaccgccctgtgttctctccctccgtctctccgtctccgtctctgtgc
cgcccagacctccgcctccgagcccgcactagcccgaggcgcgggagcaagatggccaac
tcgacgcccgtcaacggcagccacggcaaccagtcgatggagccgctgtcccacaaccgc
tacgagatggtggagatggtgttcatcgccacggtgaccggctccctcagcctggtgacg
gtggtgggcaacatcctggtcatggtctccatcaaggtcaaccggcagctccagacggtc
aacaactacttcctgttcagcctggcctgcgccgacctcatcatcggggccttctccatg
aacctctacaccgtctacatcatcaagggctactggccgctggggacggtggtctgcgac
ctgtggctggccctggactacgtggtcagcaacgcgtcggtcatgaacctgctcatcatc
agctttgaccgctacttctgcgtcaccaagcccctcacctaccccgcccggcgcaccacc
aagatggccggcctgatgatcgcggccgcctgggtcctgtccttcgtcctgtgggccccg
gccatcctcttctggcagttcctcgtgggcaagcggaccgtgccggcggaccagtgcttc
atccagttcctgtccaacccggcggccaccttcgggactgccatcgccgccttctacctg
cccgtggtcatcatgaccgtgctctacatccacatctcgctggccagccgcagccgggtc
cggaagcaccggcccgagggcgacaaggagaaaaaggccaagtctttatccttcctcagg
agccccctcatcaaacagaacaacaacaacccgcccaagaagccggctctggtggcggcg
gaggcgggggcgggtggtagggctatttttaagaaactaactttaaacagagcaactctc
tcgtcgatcgtggcctga

DBGET integrated database retrieval system