KEGG   Ornithorhynchus anatinus (platypus): 100091049Help
Entry
100091049         CDS       T01045                                 

Definition
ubiquitin carboxyl-terminal hydrolase 24-like
Orthology
K11840  
ubiquitin carboxyl-terminal hydrolase 9/24 [EC:3.4.19.12]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Brite
Enzymes [BR:oaa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100091049
Peptidases [BR:oaa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100091049
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1212 aa AA seqDB search
LHTQKSDENGNGPGDGVEFPTTNLYELESRVLTDHWSIPYKREESLGRCLIAATGLARLE
APPTLPEILCAYNCLLPHPQEPHGWLVDLVNRFGELGGFTAIQAKLHSEDIELGVSSMPW
VRLAQRAEPSCAPPMLDPVIHKMIKYVQNVEEKDVKDKKLLSIPELLSAIKLLCMRFQPD
LVTAVDDLRLDILLRMLKSPHFSAKMNSLKEVTKLIEDSTLSKSVKIAIDADRLLDWLVE
NSVLSVALEGNIDQAQYCDRIKGIIELLGSKLSLDELTKIWRIQCGQSSTVIENIHTIVA
AAAVKFSSDQLSHLFVLIQKSWETESDRVRQKLLSLIGRIGREARFDTTSAKVLEVLWDL
AHLPTLPGGLIQQALDEHLAILSDAYTIKETVKRSYIIKCIEDIKRPGEWTGLEKAKKDG
FKVCPQNPPQLVWVVPALRQLHEITRSFVKQTYQKQDKSIIQDLKKNFEIVKLVTGSLLA
CHRLAAAAATGPGGLSGSTLVDGRYTYREYLEAHLKFLAFFLQEATLYLGWSRAKEIWEC
LVTGQDVCELDREMCFEWFTKGQHDLESDVQQQLFKEKILKLESYEITMSGFGLFKAFFE
NVNLCDHRLKRQGSQLLVEKLELVGMDFIWKVCMESPDDEIANEAVQLIISYSYVNLNPR
LKKDSVSLHKKFIADCYTRLEAASSALGGPTLTHAVTRATKMLTATAMPTVATSVQSPYR
STKLVVIERLLLLAERYVITVEDLYSVPRTILPHGASFQGHLLSLSVNCDSTKDTFSFEA
HSNETVGSIRWKVAKQLNAPVDNIQIFANDSLLTVSKDQKLLHQLGFSDEQALTVKTSGS
GTPSASSADSSGSVFGSSYVMEQEKSLPGVVMALVCNVFDMLYQLATLEEPRITLRVRKL
LLLIPTDPAIQEALDQLDSLGRKRTLLSESSPQPSKSPSLSSKQQHQPGASSILESLFRS
FAPGMSAFRVLYNLEVLSSKLMPTADDEMARNCAKSFCENFLKAGGLSATMDVDDFTCTV
ACFTRLSWAAAAGRLDLVGSSLPIRETAALFPGTGRHRLSSSGSTCSSGSEGDAVALPAG
ICRRQRAVPTKDALVAGEALSLLVTCLQLRSQQLASFYTLPGVADFVIDILLGSPSAEIR
RAACDQLYSLSQTDTSPYPDVQKPNHFLLGLVLAAQLPLWSPTSVMRGANQRLLFYCTEY
FDLRCQRGGRTD
NT seq 3638 nt NT seq  +upstreamnt  +downstreamnt
ctccacacgcagaagagcgacgagaacgggaacggccccggtgacggcgtggagttcccc
acgaccaacctgtacgagctggagagccgcgtcctgaccgaccactggtcgatcccctac
aagcgcgaggagtctctgggccgctgcctcatcgctgccaccggccttgcccggcttgag
gctcccccgacccttccggaaatcctctgcgcttacaactgcctccttccccacccgcag
gagccccacggctggctggtggacttggtgaataggtttggagagctgggtgggttcacc
gccatccaggccaagctccattcggaagacatcgaacttggggtgagttccatgccctgg
gtccgcctagcacagagagctgaaccctcatgcgccccccccatgctcgatccggtcata
cacaagatgatcaaatacgtccagaatgtggaggagaaggacgtcaaggacaagaagctc
ctgagcatccccgagctgctgtcggccatcaagctgctgtgcatgcgcttccagcccgac
ctggtgaccgctgtggatgatctgcggctggacatcctgctgcgcatgctcaagtccccg
catttcagcgccaagatgaactctctcaaagaggtcaccaagctcatagaggacagcact
ctgtctaagtccgtaaagatcgctatcgatgctgaccgtctgctggactggctggtggag
aactctgtgctgtccgtcgctctggaaggtaatatagaccaagcccaatactgtgaccgt
ataaagggaattattgaattgctgggcagtaaattgtctttagatgagctcactaaaatt
tggagaatacagtgcggacagtcgtccaccgtgatcgagaacatccacaccatcgtcgcc
gccgccgccgtcaagttcagctcggaccagctcagtcacctgtttgtcctcatccagaag
agctgggagaccgaaagcgaccgggtcagacagaagctgctgagcctcatcgggcggatc
ggccgcgaagcgcgcttcgacaccacctcggcaaaggtgctggaggtgctctgggacctg
gcccatctccccacgctgcccggcggcctgatccagcaggccctggacgagcacctggcc
atcctgagcgacgcctacaccatcaaggagaccgtcaagaggagctacatcatcaaatgc
attgaagacatcaaacggcctggagaatggacgggcttggagaaggccaagaaggatggt
ttcaaggtgtgcccgcagaacccgccgcagctggtgtgggtggtgccagccctgcgtcag
ctccacgagatcacccgctcgttcgtcaagcagacctaccagaagcaggacaagagcatc
attcaggacctgaagaagaactttgagatcgtcaagctggtgacgggcagcctcctggcg
tgccaccgactggcagcggctgcggcgacggggcccgggggcctgtctgggtcaacactg
gtggatggcagatacacataccgggagtacctagaggcgcacctcaagttcctggcattt
ttcctgcaagaagctacgctctacttggggtggagccgggccaaggagatctgggagtgt
ctggtgacgggacaggacgtctgcgagctggatcgagagatgtgtttcgagtggttcacc
aaggggcagcacgatctggagagtgatgtccagcagcagctcttcaaggaaaaaattctg
aaactggaatcctacgagattaccatgagcggcttcggcttgtttaaggcgttctttgag
aacgtgaacctctgcgaccatcggctgaaacggcaaggctcacagctgttggtggagaag
ctggagctggtgggaatggatttcatctggaaagtgtgcatggagtctcccgacgacgag
atcgccaacgaggccgtgcagctcatcatcagctacagctacgtcaacctgaaccccagg
ctcaagaaggattcagtgtcgctgcacaagaagttcatcgcggactgttacacgcgactg
gaagcggccagttcggcgctaggagggcccacgttgacccacgccgtgaccagagccaca
aagatgctgacggccacggccatgccgacggtggccacgtcggtgcagtcgccatacagg
tctacgaagctggtcgtcatcgagaggctgctgctgctggccgagcgctacgtcatcact
gtcgaggacctgtactcggtgccccggaccatcctcccgcacggtgcctcgttccagggc
cacctcctgtccctcagcgtcaactgcgactccaccaaagacaccttctccttcgaggct
cacagcaacgagacggtgggcagcatccgctggaaagtcgccaagcagctcaacgcgccc
gtagacaacatccagatctttgccaacgacagcctgctgaccgtcagcaaggaccagaag
ctcctccaccagctggggttctccgacgagcaggccctcaccgtgaagacctcgggcagc
gggacgccgtccgcgagctcggccgactcctccgggagcgtcttcggctcgtcgtatgtc
atggagcaggagaagtcgctgccaggcgtggtgatggctctggtgtgcaacgtcttcgac
atgctgtaccagctggccaccctggaggaacccaggatcacgctgcgtgtgcgcaagctt
ctgctgctcatcccaaccgacccggccatccaggaggccctcgaccaactcgactccctg
gggagaaagagaacgctgctgtcggagtccagcccccagccatccaagtccccgtcgctg
tcctcgaaacagcagcaccagcccggggccagctccatcctggagagcctgttccgctcc
ttcgctcccgggatgtccgccttccgcgtgctgtacaacctcgaggtcctgagctccaag
ctgatgcccaccgcggacgacgagatggccagaaactgtgccaagtctttctgcgagaac
ttcctcaaggccggaggcctcagcgcaacgatggacgtcgacgacttcacgtgcaccgtg
gcctgtttcacgaggttgtcgtgggcggcggcggcgggcaggctggacctggtggggagc
agcctacccatccgcgagaccgcagccctgtttcccggcaccggccggcaccggctcagc
agctcaggcagcacctgcagctcggggagcgagggggatgccgtcgccctgcccgcgggg
atctgcaggcggcagcgggcggtgcccaccaaggacgcgctggtcgccggcgaggccctg
tcgctcctggtcacgtgcctccagctccggagtcagcagctcgcgtccttctacaccctg
cccggcgtggccgattttgtcatcgacatcctcctgggatcgccgagcgccgagatccgc
cgcgcggcctgcgaccagctgtacagcctgagccagacggacacgtcgccgtacccggac
gtgcagaagccgaaccatttcctgctgggcttggtcctggccgcccagctgccgctctgg
tctcccaccagcgtcatgcgcggggccaaccagcggctgctgttctattgcacggaatac
ttcgatctgcgctgccagcgcgggggacgaactgacca

DBGET integrated database retrieval system