KEGG   Ornithorhynchus anatinus (platypus): 100091153Help
Entry
100091153         CDS       T01045                                 

Gene name
MYL7
Definition
(RefSeq) myosin light chain 7
  KO
K12754  myosin regulatory light chain 7
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa04510  Focal adhesion
oaa04670  Leukocyte transendothelial migration
oaa04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    100091153 (MYL7)
  Cell motility
   04810 Regulation of actin cytoskeleton
    100091153 (MYL7)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    100091153 (MYL7)
Cytoskeleton proteins [BR:oaa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     100091153 (MYL7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_5 EF-hand_8 EF-hand_9 CHCH DUF3248 S_100
Motif
Other DBs
NCBI-GeneID: 100091153
NCBI-ProteinID: XP_007659486
UniProt: F7C824
Position
Un
AA seq 174 aa AA seqDB search
MASRKAGTRGKAAAKQAQRGSSNVFSMFEQAQIQEFKEAFSCIDQNRDGIISKSDLKETF
SQLGKLNVSDEELEEMLQEGKGPINFTVFLSLFGEKLNGTDPEDSILSAFRMFDPNGTGL
VNKDEFKQLLLTQADKFTPAEVEQMFAVTPIDMAGNIDYKSLCYIITHGDEKEE
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atggccagtaggaaggcagggaccagggggaaggcagcggccaagcaggcccagcgtggc
tcgtccaatgttttctccatgttcgagcaagcgcagatccaagagttcaaggaggctttc
agctgcatcgaccagaaccgtgatggcatcatcagcaagtcagacctgaaggaaacattc
tcccagctcgggaagctgaacgtctctgatgaggagctggaggagatgctgcaggagggg
aaaggccccatcaacttcaccgtcttcctctcgctctttggggagaaactcaacgggacg
gaccccgaagactccatcctcagtgccttccgtatgttcgatcccaatggcaccggcctg
gtgaacaaagacgagttcaagcagctcctcctgacacaggcggacaagttcacccccgct
gaggtggagcagatgtttgcagtgacacccatcgacatggcaggaaacatcgactacaag
tccttatgctacatcatcacccacggagatgagaaggaggagtga

DBGET integrated database retrieval system