KEGG   Ornithorhynchus anatinus (platypus): 100091153Help
Entry
100091153         CDS       T01045                                 

Definition
myosin regulatory light chain 2, atrial isoform-like
Orthology
K12754  
myosin regulatory light chain 7
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Focal adhesion
Tight junction
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Class
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:oaa04810]
Cellular Processes; Cell communication; Focal adhesion [PATH:oaa04510]
Cellular Processes; Cell communication; Tight junction [PATH:oaa04530]
Organismal Systems; Immune system; Leukocyte transendothelial migration [PATH:oaa04670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 143 aa AA seqDB search
MIQEFKEAFSCIDQNRDGIISKSDLKETFSQLGKLNVSDEELEEMLQEGKGPINFTVFLS
LFGEKLNGTDPEDSILSAFRMFDPNGTGLVNKDEFKQLLLTQADKFTPAEVEQMFAVTPI
DMAGNIDYKSLCYIITHGDEKEE
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgatccaagagttcaaggaggctttcagctgcatcgaccagaaccgtgatggcatcatc
agcaagtcagacctgaaggaaacattctcccagctcgggaagctgaacgtctctgatgag
gagctggaggagatgctgcaggaggggaaaggccccatcaacttcaccgtcttcctctcg
ctctttggggagaaactcaacgggacggaccccgaagactccatcctcagtgccttccgt
atgttcgatcccaatggcaccggcctggtgaacaaagacgagttcaagcagctcctcctg
acacaggcggacaagttcacccccgctgaggtggagcagatgtttgcagtgacacccatc
gacatggcaggaaacatcgactacaagtccttatgctacatcatcacccacggagatgag
aaggaggagtga

DBGET integrated database retrieval system