KEGG   Ornithorhynchus anatinus (platypus): 100091153Help
Entry
100091153         CDS       T01045                                 

Gene name
MYL7
Definition
(RefSeq) myosin light chain 7
  KO
K12754  
myosin regulatory light chain 7
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Focal adhesion
Tight junction
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100091153 (MYL7)
  Cellular community - eukaryotes
   04510 Focal adhesion
    100091153 (MYL7)
   04530 Tight junction
    100091153 (MYL7)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    100091153 (MYL7)
Cytoskeleton proteins [BR:oaa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     100091153 (MYL7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 174 aa AA seqDB search
MASRKAGTRGKAAAKQAQRGSSNVFSMFEQAQIQEFKEAFSCIDQNRDGIISKSDLKETF
SQLGKLNVSDEELEEMLQEGKGPINFTVFLSLFGEKLNGTDPEDSILSAFRMFDPNGTGL
VNKDEFKQLLLTQADKFTPAEVEQMFAVTPIDMAGNIDYKSLCYIITHGDEKEE
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atggccagtaggaaggcagggaccagggggaaggcagcggccaagcaggcccagcgtggc
tcgtccaatgttttctccatgttcgagcaagcgcagatccaagagttcaaggaggctttc
agctgcatcgaccagaaccgtgatggcatcatcagcaagtcagacctgaaggaaacattc
tcccagctcgggaagctgaacgtctctgatgaggagctggaggagatgctgcaggagggg
aaaggccccatcaacttcaccgtcttcctctcgctctttggggagaaactcaacgggacg
gaccccgaagactccatcctcagtgccttccgtatgttcgatcccaatggcaccggcctg
gtgaacaaagacgagttcaagcagctcctcctgacacaggcggacaagttcacccccgct
gaggtggagcagatgtttgcagtgacacccatcgacatggcaggaaacatcgactacaag
tccttatgctacatcatcacccacggagatgagaaggaggagtga

DBGET integrated database retrieval system