KEGG   Ornithorhynchus anatinus (platypus): 100091176Help
Entry
100091176         CDS       T01045                                 

Gene name
GCK
Definition
glucokinase (hexokinase 4)
Orthology
K12407  
glucokinase [EC:2.7.1.2]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Butirosin and neomycin biosynthesis
Metabolic pathways
Carbon metabolism
Insulin signaling pathway
Insulin secretion
Prolactin signaling pathway
Type II diabetes mellitus
Maturity onset diabetes of the young
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100091176 (GCK)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100091176 (GCK)
   00052 Galactose metabolism
    100091176 (GCK)
   00500 Starch and sucrose metabolism
    100091176 (GCK)
   00520 Amino sugar and nucleotide sugar metabolism
    100091176 (GCK)
  Biosynthesis of other secondary metabolites
   00524 Butirosin and neomycin biosynthesis
    100091176 (GCK)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    100091176 (GCK)
   04910 Insulin signaling pathway
    100091176 (GCK)
   04917 Prolactin signaling pathway
    100091176 (GCK)
 Human Diseases
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    100091176 (GCK)
   04950 Maturity onset diabetes of the young
    100091176 (GCK)
Enzymes [BR:oaa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     100091176 (GCK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 465 aa AA seqDB search
MLDHRTRMDSSKKEKVEQILSEFRLQEEDLKKVMRRMQKEMDRGLRLETHEEASVKMLPT
YVRSTPEGSEVGDFLSLDLGGTNLRVMLVKVGEGEEGQWSVKTKHQLYSIPTDAMTGTAE
MLFDYISECISDFLDKHHMKHKKLPLGFTFSFPVRHEDIDKGILLNWTKGFKASGAEGNN
IVGLLRDAIKRRGDFEMDVVAMINDTVATMISCYYEDRQCEVGMIVGTGCNACYMEEMHN
VELVEGDEGRMCVNTEWGAFGAAGELDDFLLEYDRVVDETSLNPGQQLYEKIIGGKYMGE
IVRLVLLKLVDENLLFGGEASEKLRTRGAFETRFVSQVESDCGDRKQIYNLLSTLGLRPS
PADCDIVRLACESVSTRAAQMCSAGLAGVINRMRESRLGELTRITVGVDGSVYKLHPSFK
ERFHASVRQLAPCCEITFIQSEEGSGRGAALVSAVACKKACMLAQ
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgctggaccacagaaccaggatggacagctccaagaaggagaaggtggagcaaatccta
tcagagttccggctgcaggaggaggacctgaagaaggtgatgcggaggatgcagaaggag
atggaccggggattgaggttggagacccacgaggaagccagcgtgaagatgctgcccacc
tacgtgcgatccaccccggagggctcagaggttggggatttcctctctctggatctggga
ggcacgaatttgcgcgtgatgctggtgaaggtgggggaaggcgaggaggggcagtggagt
gtgaagacaaagcaccagctgtattccatccccacagatgccatgacaggcacggcagaa
atgctcttcgattacatctccgagtgcatctcggatttcctggacaaacaccacatgaaa
cacaaaaagctgccgctgggcttcacgttctccttccccgtgcggcacgaggacattgac
aagggaatccttctcaactggacgaagggcttcaaggcatcgggtgccgaagggaacaac
atcgttggacttttgcgagacgccatcaaaaggcgaggggactttgagatggatgtggta
gctatgatcaatgacaccgtggcaaccatgatttcctgttactacgaggatcgccagtgt
gaggttggcatgatcgtaggcacggggtgcaacgcctgctacatggaggagatgcacaac
gtagagctggtggagggggacgagggccggatgtgtgtcaacacggaatggggggccttc
ggggctgcgggcgagctggacgacttcctgctggagtacgaccgggtagtggacgagacc
tccctgaaccctggtcagcagctctatgagaagattatcggcgggaagtacatgggcgag
atcgtgcggctggtgctgctgaagctggtggacgagaacctgctgttcggcggggaggcg
tccgagaagctgcggacccgaggggccttcgagactcgcttcgtctcccaggttgagagc
gactgtggagatcgtaagcagatctacaacctcctgagcaccctggggctgcggccctcg
cccgcggactgcgacatcgtgcgtctggcctgcgagagcgtctccacacgggccgcccag
atgtgctcggccgggctggccggggtcatcaaccgcatgagggagagccgcctgggggaa
ctcacacgcatcaccgtgggcgtcgacggctccgtctacaagctgcaccccagtttcaaa
gagcggttccatgccagcgtgcggcagctggcgccctgctgcgaaatcaccttcatccag
tccgaggagggcagcggccggggcgcggccctcgtgtccgccgtggcctgcaagaaggcc
tgcatgctcgcccagtga

DBGET integrated database retrieval system