KEGG   Ornithorhynchus anatinus (platypus): 100091321Help
Entry
100091321         CDS       T01045                                 

Definition
3-oxo-5-alpha-steroid 4-dehydrogenase 1-like
Orthology
K12343  
3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Steroid hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100091321
Enzymes [BR:oaa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     100091321
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 71 aa AA seqDB search
GLFEYVSGANFFGEIVEWYGYALASWSVEGAAFATFSASFLINRAQLHHRWYLEKFEDYP
KLRKILIPFLF
NT seq 218 nt NT seq  +upstreamnt  +downstreamnt
gaggcctgtttgaatatgtcagcggagccaatttctttggagagatagtggaatggtatg
gttatgcacttgccagctggtctgtggaaggtgctgcttttgccacattcagtgcttctt
ttctcatcaacagagcacaactgcatcatcggtggtatcttgagaaatttgaagactacc
caaagttgaggaaaattttaattccatttttgttttaa

DBGET integrated database retrieval system