KEGG   Ornithorhynchus anatinus (platypus): 100091330Help
Entry
100091330         CDS       T01045                                 

Definition
(RefSeq) mitogen-activated protein kinase 11-like
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa01522  Endocrine resistance
oaa04010  MAPK signaling pathway
oaa04015  Rap1 signaling pathway
oaa04068  FoxO signaling pathway
oaa04071  Sphingolipid signaling pathway
oaa04218  Cellular senescence
oaa04261  Adrenergic signaling in cardiomyocytes
oaa04370  VEGF signaling pathway
oaa04380  Osteoclast differentiation
oaa04550  Signaling pathways regulating pluripotency of stem cells
oaa04611  Platelet activation
oaa04620  Toll-like receptor signaling pathway
oaa04621  NOD-like receptor signaling pathway
oaa04622  RIG-I-like receptor signaling pathway
oaa04625  C-type lectin receptor signaling pathway
oaa04657  IL-17 signaling pathway
oaa04658  Th1 and Th2 cell differentiation
oaa04659  Th17 cell differentiation
oaa04660  T cell receptor signaling pathway
oaa04664  Fc epsilon RI signaling pathway
oaa04668  TNF signaling pathway
oaa04670  Leukocyte transendothelial migration
oaa04714  Thermogenesis
oaa04722  Neurotrophin signaling pathway
oaa04723  Retrograde endocannabinoid signaling
oaa04728  Dopaminergic synapse
oaa04750  Inflammatory mediator regulation of TRP channels
oaa04912  GnRH signaling pathway
oaa04914  Progesterone-mediated oocyte maturation
oaa04917  Prolactin signaling pathway
oaa04926  Relaxin signaling pathway
oaa04933  AGE-RAGE signaling pathway in diabetic complications
oaa05014  Amyotrophic lateral sclerosis (ALS)
oaa05132  Salmonella infection
oaa05133  Pertussis
oaa05140  Leishmaniasis
oaa05142  Chagas disease (American trypanosomiasis)
oaa05145  Toxoplasmosis
oaa05152  Tuberculosis
oaa05160  Hepatitis C
oaa05164  Influenza A
oaa05167  Kaposi's sarcoma-associated herpesvirus infection
oaa05169  Epstein-Barr virus infection
oaa05205  Proteoglycans in cancer
oaa05418  Fluid shear stress and atherosclerosis
Module
oaa_M00689  MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    100091330
   04010 MAPK signaling pathway
    100091330
   04370 VEGF signaling pathway
    100091330
   04668 TNF signaling pathway
    100091330
   04068 FoxO signaling pathway
    100091330
   04071 Sphingolipid signaling pathway
    100091330
 Cellular Processes
  Cell growth and death
   04218 Cellular senescence
    100091330
  Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100091330
 Organismal Systems
  Immune system
   04611 Platelet activation
    100091330
   04620 Toll-like receptor signaling pathway
    100091330
   04621 NOD-like receptor signaling pathway
    100091330
   04622 RIG-I-like receptor signaling pathway
    100091330
   04625 C-type lectin receptor signaling pathway
    100091330
   04660 T cell receptor signaling pathway
    100091330
   04658 Th1 and Th2 cell differentiation
    100091330
   04659 Th17 cell differentiation
    100091330
   04657 IL-17 signaling pathway
    100091330
   04664 Fc epsilon RI signaling pathway
    100091330
   04670 Leukocyte transendothelial migration
    100091330
  Endocrine system
   04912 GnRH signaling pathway
    100091330
   04914 Progesterone-mediated oocyte maturation
    100091330
   04917 Prolactin signaling pathway
    100091330
   04926 Relaxin signaling pathway
    100091330
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100091330
  Nervous system
   04728 Dopaminergic synapse
    100091330
   04723 Retrograde endocannabinoid signaling
    100091330
   04722 Neurotrophin signaling pathway
    100091330
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100091330
  Development
   04380 Osteoclast differentiation
    100091330
  Environmental adaptation
   04714 Thermogenesis
    100091330
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    100091330
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    100091330
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100091330
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100091330
  Infectious diseases
   05132 Salmonella infection
    100091330
   05133 Pertussis
    100091330
   05152 Tuberculosis
    100091330
   05164 Influenza A
    100091330
   05160 Hepatitis C
    100091330
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100091330
   05169 Epstein-Barr virus infection
    100091330
   05145 Toxoplasmosis
    100091330
   05140 Leishmaniasis
    100091330
   05142 Chagas disease (American trypanosomiasis)
    100091330
  Drug resistance
   01522 Endocrine resistance
    100091330
Enzymes [BR:oaa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100091330
Protein kinases [BR:oaa01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100091330
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 100091330
NCBI-ProteinID: XP_007656547
Position
Un
AA seq 271 aa AA seqDB search
MKHENVIGLLDVFTPASSIDTFNEVYLVTNLMGADLNNIVKCQKLTDDHIQFLVYQLLRG
LKYIHSAGIIHRDLKPSNLAVNEDCELRVGTLALGVIPSWGLLSFRHADPHSVDIWSVGC
IMAELLKGEALFPGNDYIDQLKRIMEVVGTPSSELLKKISSEHARKYIESLPHMPEQDLK
RVFRGANPLAVDLLEKMLVLDSERRVSAAEALAHAYFAQYHDPEDEPEAEPYDETIENKE
RTVDEWRELTYGEVVSFKPPDVKLDTLEIEP
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgaagcatgaaaacgtcatcggcctgctggacgtcttcaccccggcctcctccattgat
accttcaacgaagtgtacctggtgaccaacctgatgggggccgacctgaacaacatcgtc
aagtgccagaagctgacggacgaccacatccaattcctcgtctatcagcttctccggggc
ctgaagtacatccactcggcggggataatccacagggacctgaagcccagcaacctggct
gtgaacgaggactgtgaactgcgggtagggaccctcgccctcggagtcatcccgtcctgg
ggcctgctgagcttccgacacgcggacccccactctgtggacatctggtcagttggctgt
atcatggcggagctcctgaagggcgaagccctcttccccggcaatgactacatcgaccag
ctcaagaggatcatggaggtggtggggacgcccagctcggagctgctgaagaagatctcg
tctgaacatgccaggaaatacatcgagtctctgccacatatgccagagcaggatctgaag
cgggtgtttcgaggggccaatccacttgctgtggacctcctggagaagatgctggtgctg
gacagcgaacggagggtcagcgcggccgaggctctggctcacgcttacttcgcccagtac
cacgaccccgaggatgagcccgaggccgagccctacgacgagaccatcgagaacaaggag
aggacagtggacgagtggagagagctcacgtatggggaggtggtcagcttcaagcctcca
gacgtcaaactggacaccctggagatcgagccgtga

DBGET integrated database retrieval system