KEGG   Ornithorhynchus anatinus (platypus): 100091538Help
Entry
100091538         CDS       T01045                                 

Definition
thymidine phosphorylase-like
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Pyrimidine metabolism
Drug metabolism - other enzymes
Metabolic pathways
Bladder cancer
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    100091538
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    100091538
 Human Diseases
  Cancers
   05219 Bladder cancer
    100091538
Enzymes [BR:oaa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     100091538
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 157 aa AA seqDB search
MRELLEHVGCCIVGQSQELVPADRILYAARDVTATVDSRSLITASILSKKVVEGLSALIL
DVKFGEAALFPSLEQARELAETLVGVGSQLGLRVAAVLTAMDGPVGRRVGHALEVEEALE
CLEGAGPPDLRDLVTQIGMKRLYRVPCGFRRSLKIIT
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgcgggagctgttggagcacgtgggctgctgcatcgtgggccagagccaagagttggtc
cccgcggacagaatcctatacgcagcacgtgacgtgaccgccactgtggacagccgctct
ctcatcactgcatctatcctcagcaagaaggtggtggaaggcctgtccgccctcatcctg
gacgtgaagttcggagaggccgctctgttccccagcctggaacaggcccgagaacttgca
gagaccctggtgggcgtggggtcccagctgggcctgcgtgtggccgccgtgctgactgcc
atggacgggcccgtggggcgccgggtgggccacgctctggaagtggaggaggcgctggag
tgtctggaaggggcaggcccccccgacttgcgggacctcgtcacccagatcggtatgaag
aggttgtacagggtgccctgtggcttccgaagatccttgaagatcatcacgtaa

DBGET integrated database retrieval system