KEGG   Ornithorhynchus anatinus (platypus): 100091538Help
Entry
100091538         CDS       T01045                                 

Definition
thymidine phosphorylase-like
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Pyrimidine metabolism
Drug metabolism - other enzymes
Metabolic pathways
Bladder cancer
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:oaa00240]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - other enzymes [PATH:oaa00983]
Human Diseases; Cancers; Bladder cancer [PATH:oaa05219]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 290 aa AA seqDB search
MRELLEHVGCCIVGQSQELVPADRILYAARDVTATVDSRSLITASILSKKVVEGLSALIL
DVKFGEAALFPSLEQARELAETLVGVGSQLGLRVAAVLTAMDGPVGRRVGHALEVEEALE
CLEGAGPPDLRDLVTQIGMKRTLLFGSGRCSSLVSQRLSPSPSASPCRLIPSIDQRKGTG
PRERPKANRRSKRRSDRSVNQSEKGPVTAARSGRGDRKCPPSARPPPPPGQALSPKAAGG
GRLRLRRAAPSPPSPSARRRAPAHAPCSAGPRRRCGRQAGGKDGPGTHGT
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgcgggagctgttggagcacgtgggctgctgcatcgtgggccagagccaagagttggtc
cccgcggacagaatcctatacgcagcacgtgacgtgaccgccactgtggacagccgctct
ctcatcactgcatctatcctcagcaagaaggtggtggaaggcctgtccgccctcatcctg
gacgtgaagttcggagaggccgctctgttccccagcctggaacaggcccgagaacttgca
gagaccctggtgggcgtggggtcccagctgggcctgcgtgtggccgccgtgctgactgcc
atggacgggcccgtggggcgccgggtgggccacgctctggaagtggaggaggcgctggag
tgtctggaaggggcaggcccccccgacttgcgggacctcgtcacccagatcggtatgaag
aggactctcctcttcggatccggccgctgttcctctctcgtgtcacaacgcctttcccct
agcccatcggccagcccctgccgccttatcccgtcaatcgatcaacggaagggcactggc
ccccgcgagcggccgaaggccaatcgtcgcagcaaacgccggagcgatcgttcggtcaac
caatcagagaaggggccggtcaccgcagcccgaagcgggcggggggaccggaagtgcccg
ccctccgcccgccccccccccccccccggtcaggcgctttccccgaaggcggcgggcgga
gggcgcctgcgcctgcgccgtgccgcgcccagccctccctctccctccgcccggcgccgg
gcccccgcgcatgcgccctgctcggcgggcccgcggaggcggtgcgggcgccaagctggc
ggcaaggacggcccggggacgcatggaacgtag

DBGET integrated database retrieval system