KEGG   Ornithorhynchus anatinus (platypus): 100091649Help
Entry
100091649         CDS       T01045                                 

Gene name
CHP1
Definition
calcineurin-like EF-hand protein 1
Orthology
K17610  
calcineurin B homologous protein 1
Organism
oaa  Ornithorhynchus anatinus (platypus)
Brite
Protein phosphatases and associated proteins [BR:oaa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     100091649 (CHP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 195 aa AA seqDB search
MGSRASTLLRDEELEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAIN
PLGDRIINAFFPEGEDQVNFRGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFR
LYDLDKDDKISRDELLQVLRMMVGVNISDEQLGSIADRTIQEADQDGDSAISFTEFVKVL
EKVDVEQKMSIRFLH
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggggtctcgggcctccaccctgctgcgcgacgaggagctggaggagatcaaaaaggag
accggcttttcccacagtcagatcacccgcctgtacagccgattcaccagcctggacaaa
ggagagaatgggacgctcagccgggaagactttcagcgcatcccagaactcgccatcaac
cctctcggagaccggatcatcaacgccttcttcccagagggagaggaccaggtcaacttt
cgggggttcatgaggacgctggctcacttccggcccatcgaggataacgaaaagagcaaa
gacgtcaacggcccagagccgctgaacagccggagcaacaagctgcacttcgcctttcga
ctctacgacttggataaagacgacaagatctcccgtgacgaattgctgcaggtgctgcgc
atgatggtgggcgtgaacatctctgacgagcagctgggcagcatcgccgacaggaccatc
caggaagccgaccaggacggagacagcgccatctccttcacggagttcgtcaaggtgctg
gagaaggtggacgtggagcagaaaatgagcattcggttccttcactga

DBGET integrated database retrieval system