KEGG   Ornithorhynchus anatinus (platypus): 100091744Help
Entry
100091744         CDS       T01045                                 

Definition
STAM-binding protein-like
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:oaa04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 277 aa AA seqDB search
MDEINHFSKMWLPWHDLDVAGKRLYGFHPSGGHMQYIQSNGFTMEIIRFSTYTASREKHP
FLFIQTASSLIRPLTEREALVLARSLAAQRQLEEERERVARQRQQQAEQDQFRAFEELIR
RQELERERLRVEQEFGGPHPGPPEGPLTQAVATGAGERAPGGRGTSRGKRSGAGGGRSGR
LTAAGPPLALSPQMRNEFTVTHVIIPKQSAGPDYCNTENEEELFLLQDQQGLVTLGWIHT
HPTQTAFLSSVDLHTHCSYQMMLPESIAIVCSPKFCE
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atggatgaaataaaccatttctccaaaatgtggcttccgtggcacgatctagacgtagcc
gggaaacgtttgtacggattccacccgagtggagggcatatgcaatacatccaatccaat
ggattcactatggaaatcattagattttctacctacacggcatctcgagaaaagcaccct
ttcctcttcatccagactgcttcctcgctgatccgaccgctcacggagagagaggctttg
gtgctggcacggagcctggcggcccagcggcagctggaagaggagcgggagagggtggca
aggcagcggcagcagcaggccgaacaggaccagttccgcgccttcgaggagctgatccgc
cgccaggagctggagagggagcgtctgcgcgtcgagcaagagttcggcggcccgcacccc
ggcccgcccgaggggcccctgacgcaggctgtagccactggagccggggagagggccccc
gggggcagggggacgtctcgggggaagcggtcgggtgcgggaggggggcggtccgggagg
ttgacggcggcgggcccgcccctcgccctctccccgcagatgagaaacgagttcacggtg
acccacgtcatcatccccaagcagagcgccgggcccgattactgcaacacggagaacgag
gaagagctcttcctcctccaggaccagcagggcctcgtcaccctcggctggatccacact
caccccacgcagacggccttcctgtccagcgtggacctgcacacgcattgctcctaccag
atgatgctgcccgagtccatcgccatcgtctgctcccccaagttttgcgagtga

DBGET integrated database retrieval system