KEGG   Ornithorhynchus anatinus (platypus): 100091769Help
Entry
100091769         CDS       T01045                                 

Gene name
SIRT6
Definition
sirtuin 6
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Brite
Enzymes [BR:oaa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     100091769 (SIRT6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 366 aa AA seqDB search
MRSLPTVDLQVLQRAELLTHDKNPDASFRRARPPNPPRLPNPSFSPQIFDSPEELERKVW
ELAQLVQKSSNVVFHTGAGISTSSGIPDFRGPHGVWTMEERGLEPKFDTTFESARPSKTH
MALLELERVGILKFLVSQNVDGLHVRSGFPRDKLAELHGNMFVEECVKCKKQYVRDTVVG
SMGLKATGRLCSVAKGRGLRACRGELRDTILDWEDSLPDRDLNLADEACRNADLSITLGT
SLQIKPSGNLPLITKRKGGKLVIVNLQATKHDRQANLRIHGYVDEVMTKLMKHLGLEIPE
WRGPRVVEYSLPKRELGPGAESGVPGPTRARPGAEDTGSKGVKLEPPEAAVAPVAPKRVK
VESLPT
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgcgatcgctgcccacagtagatttacaggtcctgcagcgggcggaactcctcacgcac
gataagaatccagatgcctccttccggagagcaagaccccctaaccctccccggctccca
aatccttctttttctccgcagattttcgactccccagaagagctggagaggaaggtgtgg
gagttggcccagctggtgcagaaatcgtccaatgtggtgttccacacgggggcaggcatc
agcacgtcgtcaggcattccagacttcaggggcccacatggggtgtggacaatggaagaa
cgtggattggagcccaaatttgacacaacctttgagagcgccaggccctctaagacccac
atggccctgctggaactggagcgtgttggtatcctgaagttcctggtgagccaaaatgtg
gatggcttgcacgtgcgctctggattccccagggacaaactggcagagctccacggaaac
atgtttgtggaggaatgtgttaaatgcaagaagcagtacgtgcgtgacacggtggtgggc
agcatgggactcaaggcgacgggtcggctgtgcagcgtggcgaagggtcgtggcctccgg
gcctgcagaggagagctccgggacaccatcttagactgggaggactccctgccggaccgg
gacctcaacctcgcggacgaagcgtgcaggaacgccgatctgtccatcaccctgggcacc
tcgctgcagatcaagcccagcggcaatcttcccctcatcaccaagcgcaaaggtggcaag
ctggtcatcgtcaaccttcaggccaccaagcatgaccgccaggccaacctgcgcatccac
ggctacgtcgacgaggtcatgaccaagctcatgaagcacctgggcctggagatcccggag
tggcgggggccgcgggtggtcgagtactccctcccaaaacgcgaactgggccccggagcg
gagtctggagtcccgggcccgacccgggcccggcccggtgccgaggacacgggaagcaag
ggggtgaagctcgaaccccccgaggccgccgtggcccccgtggcccccaagagggtaaaa
gtggaatcccttcccacttga

DBGET integrated database retrieval system