KEGG   Ornithorhynchus anatinus (platypus): 100091769Help
Entry
100091769         CDS       T01045                                 

Gene name
SIRT6
Definition
(RefSeq) sirtuin 6
  KO
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    100091769 (SIRT6)
Enzymes [BR:oaa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     100091769 (SIRT6)
Chromosome [BR:oaa03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    SIRTs (sirtuins, class III HDACs)
     100091769 (SIRT6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 273 aa AA seqDB search
MEERGLEPKFDTTFESARPSKTHMALLELERVGILKFLVSQNVDGLHVRSGFPRDKLAEL
HGNMFVEECVKCKKQYVRDTVVGSMGLKATGRLCSVAKGRGLRACRGELRDTILDWEDSL
PDRDLNLADEACRNADLSITLGTSLQIKPSGNLPLITKRKGGKLVIVNLQATKHVSEPPG
RALVPPWGPLPVSPSPPRAGLRPDQKEPLARRALRGQARRLPRKRERQRPGSPLTCSAAA
SSPTLPRRGPRGAPRDRSVSLLLVRRGGYGWER
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atggaagaacgtggattggagcccaaatttgacacaacctttgagagcgccaggccctct
aagacccacatggccctgctggaactggagcgtgttggtatcctgaagttcctggtgagc
caaaatgtggatggcttgcacgtgcgctctggattccccagggacaaactggcagagctc
cacggaaacatgtttgtggaggaatgtgttaaatgcaagaagcagtacgtgcgtgacacg
gtggtgggcagcatgggactcaaggcgacgggtcggctgtgcagcgtggcgaagggtcgt
ggcctccgggcctgcagaggagagctccgggacaccatcttagactgggaggactccctg
ccggaccgggacctcaacctcgcggacgaagcgtgcaggaacgccgatctgtccatcacc
ctgggcacctcgctgcagatcaagcccagcggcaatcttcccctcatcaccaagcgcaaa
ggtggcaagctggtcatcgtcaaccttcaggccaccaagcatgtgagtgagccgccgggc
agagccctcgtccccccgtggggaccactgcctgtcagcccgtcccctccccgagccggc
cttaggccagaccagaaggagcctctggctcggcgggcgttgagaggccaggccagacgg
ctaccgcgaaagcgtgagaggcagcggccgggaagcccgctcacctgctcggctgccgct
tcctctccaaccctgccacggcgagggcccagaggggcccctcgagaccgcagcgtttca
cttctcttggtgcgccggggcggatacgggtgggagagatga

DBGET integrated database retrieval system