KEGG   Ornithorhynchus anatinus (platypus): 100091865Help
Entry
100091865         CDS       T01045                                 

Definition
(RefSeq) cyclin-dependent kinase 4 inhibitor D-like
  KO
K06623  cyclin-dependent kinase inhibitor 2D
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa04068  FoxO signaling pathway
oaa04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100091865
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    100091865
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank_5 Ank_4 Ank Ank_3
Motif
Other DBs
NCBI-GeneID: 100091865
NCBI-ProteinID: XP_007659496
Position
Un
AA seq 171 aa AA seqDB search
MLREDEIRAGDRLSGAAARGDLAEVRRLLHQELVHPDAVNRFGRTALQTMMFGSSPIALE
LLKQGANPNVQDATGTTPVHDAARTGFLDTLQALVEHGADVNIPDAEGSLPFHLAMRERH
VPVMAYLASRTKFKLRDPGSHDPPEPEEQPGWVETPEMADPPERDSPPTML
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgggaagacgagatccgcgccggagaccggttaagcggcgccgccgcccggggt
gacttggccgaggtgcggcgcctcttacaccaggagttggtgcatcccgatgccgtgaac
cgtttcggccgcaccgcgctgcagaccatgatgtttggtagctctcccattgccctggag
ctactgaagcaaggagccaaccccaacgtccaggatgcgacgggtacgacacccgttcac
gatgctgcccgcaccggctttctggacaccctgcaagccctggtggaacacggggctgac
gtgaatataccggatgccgaggggtccctgcctttccatctagccatgcgtgagaggcac
gtccccgtgatggcctacctggcctcacgaaccaaattcaagctccgggaccccggcagc
catgatccacccgagccagaggagcagccagggtgggtcgagacccccgagatggcagac
cccccagagagggactcccctcccaccatgctgtga

DBGET integrated database retrieval system