KEGG   Ornithorhynchus anatinus (platypus): 100091952Help
Entry
100091952         CDS       T01045                                 

Gene name
USP36
Definition
ubiquitin specific peptidase 36
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.1.2.15]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Brite
Enzymes [BR:oaa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100091952 (USP36)
Peptidases [BR:oaa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100091952 (USP36)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1138 aa AA seqDB search
MPIVDKLKEALKPGRKDSADDAELGKLLASSAKKVLLQKIEFEPASKSFSYQLEALKSKY
VLLNPKSEGAGRHKTWEDAPVRRQGSDHGLGSSSGGDGVPAPQKVLFPTERLSLRWERVY
RVGAGLHNLGNTCFLNSTIQCLTYTPPLANYLLSKEHSRSCAPGGFCMLCVMQNHMIQTF
ANSGNAIKPFSFIRDLKKIARHFRFGSQEDAHEFLRYTIDAMQKACLNGHAKLDRQTQAT
TLVHQIFGGYLRSRVKCSLCKSVSDTYDPYLDVALEIRQTANIVRALELFVKPDVLSGEN
AYMCAKCKKKVPASKRFSIHRASNVLTLSLKRFANFCGGKITKDVGYPEFLNIRPYMSQS
SGDPVMYGLYAVLVHSGYSCHAGHYYCYVKASNGQWYQMNDSSVHSSNIKVVLNQQAYVL
FYLRIPGFKKSPEGPISKAPPTPANRTNSIGPDHVKKIISNGALSSPLIGKRQDGGPRKK
PQVTEETGVVVPRSSVTAGPRPQNGTPQSKLPPRCPSPKPSAKPSPTSPEEPGKKVKKPV
PLQRFPAGPNGTGEPCGSKPQSRRPGSWEGREAAPASSPRLPEATAVNGHGPKGAGGSGG
GSDPDGGDSSSSSPERSSGSDAGARGPPTPRGGAARFRPPRETDPPAGERTEEPPGGGDP
KGAKSPSSPPTNTAAVEPANAMSPPPAKKLALSARKASTLRRATSNDLRPPPHPSIADHT
YPTKTTHLVFASPWPVSKARADSPPKSSLSLPSKFTFCSPPALKASTRPSCCSPASAPQP
QVNGDPGSPPPQRQQGASPAPPSFSGKKRNRHSGETESQSGPEAESSPGNGQGTEPRQGK
KRRRRRRHGEDGHRRPAAGPESLAWEDRAGRGDGSRGARREAEPESRDENQEPGGSQVGD
RTDAHRHRRRKKRKEEEQEEEEEQETTDEASHHQSRKKKKKKKRKQEEQEESGDPSQQPN
SDSSSVQAETPAEAPKKNKKRKRDSEQEAEESEPRPTPSGALCEDGDPLGTADGLRPRVN
GLGKEKVPQSPAEEQNTSSVLQELLRYSSDRAYGKQVLTWSGEISAVSQDAIQDSRLARS
EMVIDDWDEEFDRGKVKKFRKFKPEKKRNFNAFQKLQSRRNFWSATHPAKASSLSYRR
NT seq 3417 nt NT seq  +upstreamnt  +downstreamnt
atgcctatagtggacaagctgaaggaagccctgaagcccggccggaaggactcggccgac
gacgccgagctgggcaagctcctggcctcttccgccaagaaggtgctcctccagaagatc
gagtttgagccggccagcaagagcttctcctaccagctggaggcactcaaaagcaaatac
gtgctgctgaaccccaagtccgagggcgccggccgccacaagacctgggaggatgccccc
gtccggagacaggggagcgaccacgggctgggaagcagcagcggcggggacggcgtgcca
gccccccagaaagtcctcttccccacggagcggttgtccctgaggtgggagcgggtctac
cgcgtcggggcgggcctccacaacctgggcaacacctgcttcctcaactccaccatccag
tgtctgacctacacgccccccctcgccaactacctgctgtccaaggagcacagtcgcagt
tgtgccccgggaggcttctgtatgctctgcgtcatgcagaaccacatgatccagaccttc
gccaacagcgggaatgccatcaagcctttttccttcatccgagacctgaaaaagatcgcc
cggcacttccgcttcgggagccaagaggatgctcacgagttcctacgctatacgatcgac
gccatgcagaaggcctgcctgaacggccacgccaagttggatcggcaaacccaggccact
actctggttcatcagatttttggaggatatctccgttctcgtgtgaagtgctcgctgtgc
aagagcgtctcggacacgtatgacccctacctggacgtggctctggagatcaggcaaacg
gccaacatcgtgcgggccctggagctgtttgtcaaaccggacgtcctgagcggagagaat
gcgtacatgtgcgccaagtgcaagaaaaaggtgccggccagcaagcgattttccatccac
cgggcctccaacgtcctcaccctgagcctcaagcgcttcgccaacttctgcgggggcaag
atcaccaaggacgtgggctatccggaattcctcaacatccggccgtacatgtctcagagc
agcggggacccggtgatgtacgggctctacgcggtcctggtccactcgggctacagttgc
cacgccgggcactattactgctacgtcaaggccagtaacgggcagtggtaccagatgaac
gactcctccgtccattctagcaacatcaaagtggtcctgaaccagcaggcttacgtgctg
ttctatctcagaattccagggttcaaaaagagccccgagggccccatctccaaagccccc
ccgacccccgccaaccgaaccaacagcatcggcccggaccacgtcaagaagatcatcagc
aacggggctctctcgtcacctctgatcgggaagcggcaggacggcgggcccaggaagaag
ccccaggtgacggaggagacaggcgtggtggtgcccaggagcagcgtgacggcggggccc
agaccgcagaacggaacacctcagtcgaagctcccgccccggtgcccgtccccgaagccg
tcggcgaagcccagtcccacgagcccggaagagccgggcaagaaggtcaagaagccggtc
cccctgcagcggttccccgcgggccccaacggcacgggcgagccgtgtggcagtaagcct
cagagccgccggccggggtcctgggaaggcagggaagcggccccggcctcctctccgcgg
ctcccggaggcgaccgcggtcaacgggcacggccccaagggcgccggcggcagcggcggc
ggctcggaccccgacgggggagattccagcagctccagccccgagcgctcttccggcagc
gacgcgggggcccggggcccgccgacacccaggggcggagcggcccgcttccgcccgccc
cgggaaacggacccccccgccggcgagcggaccgaggaaccgcccgggggaggggacccc
aagggggccaagtcgccgtcttcgccgccgaccaacacggcggccgtcgagcccgccaac
gccatgtcgcctccgccggccaagaagctggccctctccgccaggaaggccagcaccttg
cggagggcgaccagcaatgacctccgtccacctccccacccatccatcgccgaccacacc
taccccacgaaaaccacccaccttgtcttcgcctctccttggcctgtcagtaaagccagg
gccgactcccctcccaagtcatccttgagtctgccttccaagtttaccttctgcagcccc
cccgcgctcaaagcctcaacccggccctcctgctgctctcctgcctccgccccccagcct
caggtcaacggggacccagggtcccctcccccccagcggcagcagggagccagccccgcc
ccacccagcttctcggggaagaagaggaaccggcattccggggagaccgagtcccagagc
ggcccggaggcggaatcctctccgggaaacggacagggcactgagccccgtcagggcaag
aagaggaggaggaggaggaggcacggggaagacgggcacagacgcccggccgccggcccg
gagtccctagcgtgggaggaccgggcagggagaggggacgggagccgaggggcccggcgg
gaggccgagccggagtcccgggacgagaatcaggagcccggcggcagccaggtgggagac
aggacggacgcccatcgccacaggaggaggaagaagaggaaggaggaggagcaggaggaa
gaggaggagcaggagacgacggacgaggcctcccaccaccaaagtagaaagaagaagaag
aaaaagaagaggaagcaagaagaacaggaggaaagcggtgaccctagccagcagccaaat
tcggacagcagctcggttcaggcggagaccccggcggaggccccgaagaagaataagaag
agaaagcgagattcagagcaggaagcggaggaaagcgagccgcgtccgacacccagcggt
gccctctgcgaggatggcgacccgctggggactgccgacggcctgcggcccagagtcaac
gggcttgggaaggagaaggtcccccagtcccccgcagaggagcagaacacatccagcgtg
ctccaggagctgctcaggtattcgtccgacagagcctacggaaaacaagtcctgacctgg
agcggggagatctcggccgtgagtcaggatgccatccaggacagcagattggctcggagt
gagatggtgattgacgactgggatgaggaatttgaccgggggaaggtgaaaaagttcagg
aagttcaagccggagaagaagcggaacttcaacgccttccagaagctgcagagtcgtcgc
aacttttggtccgcgacccacccggcgaaggccagcagcctcagctaccggcgctga

DBGET integrated database retrieval system