KEGG   Ornithorhynchus anatinus (platypus): 100091970Help
Entry
100091970         CDS       T01045                                 

Definition
cytochrome P450 3A19-like
Orthology
K07424  
cytochrome P450, family 3, subfamily A [EC:1.14.14.1]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Steroid hormone biosynthesis
Linoleic acid metabolism
Retinol metabolism
Metabolic pathways
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100091970
   00591 Linoleic acid metabolism
    100091970
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100091970
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100091970
Enzymes [BR:oaa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100091970
Cytochrome P450 [BR:oaa00199]
 Cytochrome P450, animal type
  CYP3 family
   100091970
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 404 aa AA seqDB search
NLRLNGGLDSSLTIAEYHTWKRIRTIVSPAFTSGKLKEMFPIIKHYGKILVQNIDKKVKK
NEPVNMKEIFGSYSLDVVTSTSFGVDIDSMNNPNDPFVKQINKLLSFTFLSPLILLTVVC
PFLVPVFEKMNLSLFPREFLEFFVGVTRNFKEKRQKGVHTGRVDFLQLMVDSQSSDSNSE
PSEKNHSYKEMTDTEISTQAIIFIFAGFETTSSTLNFVSYNLATHPEVQKKLQEEIDSIL
PNKASPTYESISQMDYLDMVVQETLRLFPPGGRIERVCKETIQIKGLTIPKGTVVIIPAF
VLHRDPEHWPEPEKFLPERFSKEEKASHNPYVFLPFGAGPRNCIGMRFALLNMKAALIHL
LQNFSVEPCKETPMPLELDSTGFMKPKKPIILKLVPRSGVDSED
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
aacttgcgtctaaatggtggcttggactctagcctcaccatcgccgagtatcacacgtgg
aagaggattcgcaccatcgtctccccggccttcaccagtgggaaacttaaggagatgttc
ccaatcatcaaacattatggaaaaattctggtgcaaaatattgacaagaaggtgaagaag
aatgagccagtgaatatgaaggagatctttgggtcgtacagtctggacgtggtcaccagt
acctcctttggagtggacatagattcgatgaacaatcccaatgacccttttgttaaacag
atcaataagttactctctttcactttcttaagccctctgatcctgctcacagtggtgtgt
cctttcctcgtgccagttttcgaaaagatgaacctgtcactgtttccccgggagttcttg
gaattctttgttggcgtcacccgcaacttcaaagagaagaggcagaaaggtgtccacacg
ggaagagtggattttctgcaactgatggttgactcccaatcctcagacagcaactctgaa
cccagtgagaagaatcactcctacaaagaaatgactgacacggagatctcgacacaggcc
atcatctttatttttgctggatttgaaaccaccagctcgactctcaacttcgtgtcctac
aacttggctactcaccctgaagtccagaagaaactgcaagaggaaatagacagcattcta
cctaacaaggccagccccacttatgagtccatctcccagatggattatctcgatatggtt
gtccaggagactctcaggctcttccccccaggaggtcgaatagagagagtctgtaaggaa
acgatccaaatcaaagggttgaccattcccaaagggacagtggttattataccagcattt
gttctgcatcgggatccagagcattggccagagcctgaaaagttcctccctgagaggttc
agtaaggaagagaaagcttcgcacaatccctatgtcttcctgccctttggagccggtccc
agaaactgcattggaatgagatttgccctcctcaacatgaaagctgctctgattcacctg
ctgcagaatttctccgtggagccttgcaaagagaccccgatgcccctagaactggattcg
acgggttttatgaaacccaagaagccgatcattctgaaactcgtccccagatcaggagtg
gattctgaagactag

DBGET integrated database retrieval system