KEGG   Ornithorhynchus anatinus (platypus): 100092325Help
Entry
100092325         CDS       T01045                                 

Gene name
CDC27
Definition
cell division cycle 27 homolog (S. cerevisiae)
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Cell cycle
Oocyte meiosis
Ubiquitin mediated proteolysis
Progesterone-mediated oocyte maturation
HTLV-I infection
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:oaa04120]
Cellular Processes; Cell growth and death; Cell cycle [PATH:oaa04110]
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:oaa04114]
Organismal Systems; Endocrine system; Progesterone-mediated oocyte maturation [PATH:oaa04914]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:oaa05166]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 385 aa AA seqDB search
ENSKKLKMKFPPKIPNRKTKSKTNKGGITQPNINDSLEITKLDSSIISEGKISAVTPQIQ
AFTLQKAAAEGLMSLLRDMGKGYLALCSYNCKEAINLLSHLPSHHYNTGWVLGQIGRAYF
ELSEYMQAERIFSEVRRIENYRVEGMEIYSTTLWHLQKDVALSVLSKDLTDMDKNSPEAW
CAAGNCFSLQREHDIAIKFFQRAIQVDPNYAYAYTLLGHEFVLTEELDKALACFRNAIRV
NPRHYNAWYGLGMIYYKQEKFSLAEMHFQKALDINPQSSVLLCHIGVVQHALKKSEKALD
TLNKAIIIDPKNPLCKFHRASVLFANEKYKSALQELEELKQIVPKESLVYFLIGKVKIGA
MKIIMGKGNFPHFSLINEERNKQLQ
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
gagaacagcaagaagttaaaaatgaagtttccacctaaaattccaaaccgaaaaacaaaa
agtaaaacaaacaaaggcgggataactcagcccaacatcaatgatagtctggaaataacc
aaattggactcctccatcatttcggaagggaagatctcggcagtgaccccccagatccag
gctttcactcttcagaaagcagccgcagaaggtttgatgagccttcttcgtgatatggga
aaaggttatttagctttgtgttcatacaactgcaaagaagctataaatctattgagccac
ctcccttcacaccactacaatactggttgggtgctgggccaaattgggagagcttatttt
gaactctcagagtacatgcaggctgaaaggatcttctccgaagttagacggattgaaaac
tacagagtcgaaggcatggaaatctactctacaaccctttggcatctgcagaaagacgtc
gccctctctgttctctcaaaggatttaacagacatggataaaaactccccagaggcctgg
tgtgctgcaggaaactgttttagtttgcagcgagagcatgatattgcaattaaatttttc
cagagagctatccaagttgatccaaactatgcttatgcctatactctgctggggcatgaa
tttgtattgactgaagaattagacaaagcacttgcctgtttcaggaatgcaatccgagtc
aaccccagacattacaatgcttggtatggcctgggcatgatttattacaagcaagaaaaa
ttcagcctggccgaaatgcacttccagaaggcacttgacatcaacccacagagctcagtc
ttactttgccatattggagtggttcagcatgcactgaaaaaatctgaaaaggctttggat
acgttaaataaagccatcattattgaccccaagaacccactatgcaaattccacagagcc
tcagtcttatttgcaaatgaaaaatataagtctgctttacaggaacttgaagaattgaaa
cagattgtccccaaagagtctcttgtttacttcttaataggaaaggtaaaaatcggggct
atgaaaatcatcatgggaaaagggaactttccccacttcagcttaataaatgaggaaaga
aacaagcagctgcag

DBGET integrated database retrieval system