KEGG   Ornithorhynchus anatinus (platypus): 100092325Help
Entry
100092325         CDS       T01045                                 

Gene name
CDC27
Definition
cell division cycle protein 27 homolog
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Cell cycle
Oocyte meiosis
Ubiquitin mediated proteolysis
Progesterone-mediated oocyte maturation
HTLV-I infection
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100092325 (CDC27)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    100092325 (CDC27)
   04114 Oocyte meiosis
    100092325 (CDC27)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100092325 (CDC27)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    100092325 (CDC27)
Protein phosphatases and associated proteins [BR:oaa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     100092325 (CDC27)
Ubiquitin system [BR:oaa04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     100092325 (CDC27)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 385 aa AA seqDB search
ENSKKLKMKFPPKIPNRKTKSKTNKGGITQPNINDSLEITKLDSSIISEGKISAVTPQIQ
AFTLQKAAAEGLMSLLRDMGKGYLALCSYNCKEAINLLSHLPSHHYNTGWVLGQIGRAYF
ELSEYMQAERIFSEVRRIENYRVEGMEIYSTTLWHLQKDVALSVLSKDLTDMDKNSPEAW
CAAGNCFSLQREHDIAIKFFQRAIQVDPNYAYAYTLLGHEFVLTEELDKALACFRNAIRV
NPRHYNAWYGLGMIYYKQEKFSLAEMHFQKALDINPQSSVLLCHIGVVQHALKKSEKALD
TLNKAIIIDPKNPLCKFHRASVLFANEKYKSALQELEELKQIVPKESLVYFLIGKVKIGA
MKIIMGKGNFPHFSLINEERNKQLQ
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
gagaacagcaagaagttaaaaatgaagtttccacctaaaattccaaaccgaaaaacaaaa
agtaaaacaaacaaaggcgggataactcagcccaacatcaatgatagtctggaaataacc
aaattggactcctccatcatttcggaagggaagatctcggcagtgaccccccagatccag
gctttcactcttcagaaagcagccgcagaaggtttgatgagccttcttcgtgatatggga
aaaggttatttagctttgtgttcatacaactgcaaagaagctataaatctattgagccac
ctcccttcacaccactacaatactggttgggtgctgggccaaattgggagagcttatttt
gaactctcagagtacatgcaggctgaaaggatcttctccgaagttagacggattgaaaac
tacagagtcgaaggcatggaaatctactctacaaccctttggcatctgcagaaagacgtc
gccctctctgttctctcaaaggatttaacagacatggataaaaactccccagaggcctgg
tgtgctgcaggaaactgttttagtttgcagcgagagcatgatattgcaattaaatttttc
cagagagctatccaagttgatccaaactatgcttatgcctatactctgctggggcatgaa
tttgtattgactgaagaattagacaaagcacttgcctgtttcaggaatgcaatccgagtc
aaccccagacattacaatgcttggtatggcctgggcatgatttattacaagcaagaaaaa
ttcagcctggccgaaatgcacttccagaaggcacttgacatcaacccacagagctcagtc
ttactttgccatattggagtggttcagcatgcactgaaaaaatctgaaaaggctttggat
acgttaaataaagccatcattattgaccccaagaacccactatgcaaattccacagagcc
tcagtcttatttgcaaatgaaaaatataagtctgctttacaggaacttgaagaattgaaa
cagattgtccccaaagagtctcttgtttacttcttaataggaaaggtaaaaatcggggct
atgaaaatcatcatgggaaaagggaactttccccacttcagcttaataaatgaggaaaga
aacaagcagctgcag

DBGET integrated database retrieval system