KEGG   Ornithorhynchus anatinus (platypus): 100092330Help
Entry
100092330         CDS       T01045                                 

Definition
renin-like
Orthology
K01380  
renin [EC:3.4.23.15]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Renin-angiotensin system
Class
Organismal Systems; Endocrine system; Renin-angiotensin system [PATH:oaa04614]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 388 aa AA seqDB search
MGPETTLVTSEQRISLRKMPSLRECMREQGQVTMKTDAELGFSAGPGSLENRTVPMLLTN
YLDAQYFGEIGIGSPAQTFKVIFDTGSANLWVPSINCKPIHSACETHNLYDASQSQTYME
NGTQIAISYVSGTVKGFLSQDLVTIGGIPVIQMFAEITTLPTSSFMYAKFDGVLGMGYPA
QAIGGITPVFDHILTQHVLKEDVFSVYYSRNSKNDHMVPGGEIILGGRDPTYYQGDFYYL
DVSKKGFWQVNMKGVSVDRTLQFCQEGCAAMVDTGATLITGPVKDVKHMMDILGAQKIGG
NMYAVDCKEVAQLPDISFHLGGRVFPLSSSDYVLQDSDFDDVLCPLAFKGVDVHPPLGPL
WVLGASFIRRYYIEFDRQNNRIGFAMAR
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgggtcctgaaactacattggtgacctctgagcagaggatctctctgaggaagatgccc
tctctccgggaatgcatgcgagagcagggtcaggtcaccatgaagacggacgctgaacta
ggcttctctgctggcccggggtcccttgaaaacaggacagtccccatgcttctcaccaac
tacttggacgcgcagtactttggcgagatcggcatcggcagcccagctcagaccttcaaa
gtcatcttcgacacgggctctgccaacctctgggtgccttccatcaactgcaagcctatc
cactctgcctgcgaaacccataacctctacgacgcctcccaatcgcagacgtacatggaa
aacgggacccaaatagccatcagctacgtctcggggacagtgaaaggattcttgagccag
gacttggtgaccattggtggcatcccagtcattcagatgtttgccgagatcacgaccctg
cccacttcctccttcatgtatgccaagtttgatggggtgctgggcatgggctaccccgcc
caggccattggcggcatcacccccgtgttcgaccacatcctcacccagcatgtcctgaag
gaagatgtcttctctgtctactacagcaggaattccaagaatgaccacatggtgcccggc
ggagagatcatcctgggaggacgtgacccgacctattaccaaggcgacttctactacctg
gatgtcagcaagaagggcttctggcaggtcaacatgaagggggtgtccgtagatcgtact
ctacagttctgccaggagggttgtgccgccatggttgacaccggggccacgctcatcact
ggcccagttaaggacgtgaagcacatgatggacatcctcggggctcagaagattggagga
aacatgtatgctgtggactgtaaggaggtggctcagctccctgacatctcgttccatctt
ggaggaagagtctttccactcagcagctcagactatgtcctccaggattctgacttcgac
gacgtcctctgccccttggccttcaaaggagtcgacgttcatcctcctcttgggcccctc
tgggttctgggtgccagcttcatccgccgctactacatcgagttcgaccggcaaaacaac
cgcattggcttcgccatggcccgttga

DBGET integrated database retrieval system