KEGG   Ornithorhynchus anatinus (platypus): 100092330Help
Entry
100092330         CDS       T01045                                 

Gene name
REN
Definition
renin
Orthology
K01380  
renin [EC:3.4.23.15]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Renin-angiotensin system
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Organismal Systems
  Endocrine system
   04614 Renin-angiotensin system
    100092330 (REN)
Enzymes [BR:oaa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.15  renin
     100092330 (REN)
Peptidases [BR:oaa01002]
 Aspartic Peptidases
  Family A1: pepsin family
   100092330 (REN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 370 aa AA seqDB search
MPSLRECMREQGQVTMKTDAELGFSAGPGSLENRTVPMLLTNYLDAQYFGEIGIGSPAQT
FKVIFDTGSANLWVPSINCKPIHSACETHNLYDASQSQTYMENGTQIAISYVSGTVKGFL
SQDLVTIGGIPVIQMFAEITTLPTSSFMYAKFDGVLGMGYPAQAIGGITPVFDHILTQHV
LKEDVFSVYYSRNSKNDHMVPGGEIILGGRDPTYYQGDFYYLDVSKKGFWQVNMKGVSVD
RTLQFCQEGCAAMVDTGATLITGPVKDVKHMMDILGAQKIGGNMYAVDCKEVAQLPDISF
HLGGRVFPLSSSDYVLQDSDFDDVLCPLAFKGVDVHPPLGPLWVLGASFIRRYYIEFDRQ
NNRIGFAMAR
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgccctctctccgggaatgcatgcgagagcagggtcaggtcaccatgaagacggacgct
gaactaggcttctctgctggcccggggtcccttgaaaacaggacagtccccatgcttctc
accaactacttggacgcgcagtactttggcgagatcggcatcggcagcccagctcagacc
ttcaaagtcatcttcgacacgggctctgccaacctctgggtgccttccatcaactgcaag
cctatccactctgcctgcgaaacccataacctctacgacgcctcccaatcgcagacgtac
atggaaaacgggacccaaatagccatcagctacgtctcggggacagtgaaaggattcttg
agccaggacttggtgaccattggtggcatcccagtcattcagatgtttgccgagatcacg
accctgcccacttcctccttcatgtatgccaagtttgatggggtgctgggcatgggctac
cccgcccaggccattggcggcatcacccccgtgttcgaccacatcctcacccagcatgtc
ctgaaggaagatgtcttctctgtctactacagcaggaattccaagaatgaccacatggtg
cccggcggagagatcatcctgggaggacgtgacccgacctattaccaaggcgacttctac
tacctggatgtcagcaagaagggcttctggcaggtcaacatgaagggggtgtccgtagat
cgtactctacagttctgccaggagggttgtgccgccatggttgacaccggggccacgctc
atcactggcccagttaaggacgtgaagcacatgatggacatcctcggggctcagaagatt
ggaggaaacatgtatgctgtggactgtaaggaggtggctcagctccctgacatctcgttc
catcttggaggaagagtctttccactcagcagctcagactatgtcctccaggattctgac
ttcgacgacgtcctctgccccttggccttcaaaggagtcgacgttcatcctcctcttggg
cccctctgggttctgggtgccagcttcatccgccgctactacatcgagttcgaccggcaa
aacaaccgcattggcttcgccatggcccgttga

DBGET integrated database retrieval system