KEGG   Ornithorhynchus anatinus (platypus): 100092492Help
Entry
100092492         CDS       T01045                                 

Definition
mitogen-activated protein kinase kinase kinase 12-like
Orthology
K04423  
mitogen-activated protein kinase kinase kinase 12 [EC:2.7.11.25]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100092492
Enzymes [BR:oaa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     100092492
Protein kinases [BR:oaa01001]
 Serine/threonine protein kinases: TKL group
  MLK family
   100092492
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 385 aa AA seqDB search
MACLHETRTPSPSFGGFVAALSEAPVRRPDPEASDCTPEKDLTPTQCVLRDVVPLGGGVP
GGSPGGGGGGGALASEPFANSVLQLHEGEAGGAGAAGTPEARTPRFRADEVRLQCQSGGG
GFLEGLFGCLRPVWTMIGKAYSTDHKQQEAPWEVPFEEIRDLQWVGSGAQGAVFLGRFHG
EDVAVKKVRDLKETDIKHLRRLKHPNIITFKGVCTQAPCYCILMEFCAQGQLFEVLRAGR
PVTPSLLVDWSMGIAGGMNYLHLHKIIHRDLKSPKMAPEVIRNEPVSEKVDIWSFGVVLW
ELLTGEIPYKDVDSSAIIWGVGSNSLHLPVPSSCPDGFKILLRQCWNSKPRNRPSFRQIL
LHLDIASADVLSTPQETYFKSQVGI
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggcctgcctgcacgagacccgcaccccttccccgtccttcggcggcttcgtggccgcg
ctgagcgaggctccggtccgcaggccggacccggaggcgtcggactgcacccccgagaag
gacctgacccccacgcagtgcgtcctccgcgatgtggtccccctcggaggaggggtcccg
gggggctcccccggcgggggtgggggcggcggggctctcgcctccgagcccttcgccaac
agcgtgctgcagctccacgagggcgaggccgggggcgcgggcgccgccgggacccccgag
gccaggaccccccgcttcagggccgacgaggtccggctgcagtgtcagagcggaggcggc
ggcttcctggaggggctcttcggctgcctgcgtcccgtctggaccatgatcggaaaggcc
tactccactgaccacaagcagcaggaagcgccctgggaagtgcccttcgaggagatccgg
gacctgcagtgggtgggctcgggggcccagggcgccgtcttcctgggccgcttccacggc
gaagacgtggccgtgaagaaggtgcgggacctcaaggagaccgacatcaagcacctgcgg
cggctcaagcaccccaacatcatcaccttcaagggcgtgtgcacccaggctccctgctac
tgcatcctcatggagttctgcgcccagggccagctgttcgaggtcctccgggccgggcgg
ccggtcaccccgtccctgctggtcgactggtccatgggcatcgcgggtggcatgaattac
ctacacctgcacaaaatcatccaccgagacctcaagtcgcccaagatggcgcccgaggtc
atccggaacgagcccgtgtccgagaaagtggacatctggtcgtttggcgtggtgctgtgg
gagctgctgaccggtgagatcccgtacaaggacgtggactcctcggccatcatctgggga
gtgggcagcaacagcctccacctgcccgtgccttccagttgtcccgacggtttcaagatc
ctcttacgccagtgctggaacagcaagccccggaaccggccgtccttcaggcagatcctg
ctgcacctggacatcgcctccgccgacgtcctctccactccccaggagacctacttcaaa
tctcaggtgggaatctag

DBGET integrated database retrieval system