KEGG   Ornithorhynchus anatinus (platypus): 100092513Help
Entry
100092513         CDS       T01045                                 

Definition
probable histone acetyltransferase MYST1-like
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 132 aa AA seqDB search
ITKVKYVDKIHIGNYEIDAWYFSPFPEDYGKQPKLWLCEYCLKYMKFEKSYRFHLGQCQW
RQPPGKEIYRKNNISVYEVDGKDHKIYCQNLCLLAKLFLDHKTLYFDVEPFVFYILTEVD
RQGAHIVGYFSK
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atcaccaaggtgaagtacgtggacaagattcacattgggaactacgaaatcgatgcctgg
tatttctccccgttcccggaggattacgggaagcagcccaaactctggctctgcgagtac
tgtctcaagtacatgaagtttgagaagagctaccggttccacctggggcagtgccagtgg
agacagccccccggcaaggaaatctaccgcaaaaacaacatctctgtgtatgaggtcgat
ggcaaagaccataagatttactgtcagaatctgtgcctgctggctaaactcttcctggac
cacaagaccctctacttcgacgtggagcccttcgtcttctacatcctgaccgaagtcgat
cggcaaggggcgcacatagtgggctacttctccaag

DBGET integrated database retrieval system