KEGG   Ornithorhynchus anatinus (platypus): 100092691Help
Entry
100092691         CDS       T01045                                 

Definition
AP-2 complex subunit beta
Orthology
K11825  
AP-2 complex subunit beta-1
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Endocytosis
Synaptic vesicle cycle
Endocrine and other factor-regulated calcium reabsorption
Huntington's disease
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100092691
 Organismal Systems
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100092691
  Nervous system
   04721 Synaptic vesicle cycle
    100092691
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    100092691
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 822 aa AA seqDB search
MTVGKDVSSLFPDVVNCMQTDNLELKKLVYLYLMNYAKSQPDMAIMAVNSFVKDCEDPNP
LIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQMVEDQG
FLDSLRDLIADSNPMVVANAVAALSEISESHPNSNLLDLNPQNINKLLTALNECTEWGQI
FILDCLSNYNPKDDREAQSICERVTPRLSHANSAVVLSAVKVLMKFLELLPKDSDYYNML
LKKLAPPLVTLLSGEPEVQYVALRNINLIVQKSRPAKRVRAIGRCAIKVEQSAERCVSTL
LDFIQTKVNYVVQEAIVVIRDIFRKYPNKYESIIATLCENLDSLDEPDARAAMIWIVGEY
AERIDNADELLESFLEGFHDESTQVQLTLLTAIVKLFLKKPSETQELVQQVLSLATQDSD
NPDLRDRGYIYWRLLSTDPVTAKEVVLSEKPLISEETDLIEPTLLDELICHIGSLASVYH
KPPNAFVEGGHGIHRKHLPIHHGSTDAGDSPVGAAAAAATAANLEQPQVIPSQGDLLGDL
LNLDLGPPVNVPQVSSMQMGAVDLLGGGLDSLVGQSFIPSSVPATFAPSPTPAVVSSGLN
DLFELSTGIGMAPGGFVAPKAVWLPAVKAKGLEISGTFTHRQGHVYMDMNFTNKALQHMT
DFAIQFNKNSFGVIPSAPLAIHTPLMPNQSIDISLPLNTLGPVMKMEPLNNLQVAVKNNI
DVFYFSCLIPLNVLFVEDGKMERQVFLATWKDIPNENELQFQIKECHLNADAVSSKLQNN
NVYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYT
NT seq 2466 nt NT seq  +upstreamnt  +downstreamnt
atgactgtggggaaggacgtcagctccctcttcccggacgtggtcaactgcatgcagacg
gacaacctggagctgaagaagctggtctacctctatctgatgaactacgccaagagccag
ccggacatggccatcatggccgtcaacagcttcgtcaaggactgcgaggaccccaacccg
ctgatccgggccctggcggtgcgcaccatggggtgcatccgggtggacaagatcacggaa
tacctgtgcgagccgctgcgcaagtgcctgaaggacgaggacccgtacgtgcggaagacg
gccgccgtgtgcgtggccaagctgcacgacatcaacgcccagatggtggaggaccagggc
ttcctggactccctgcgggacctcatcgccgactccaaccccatggtggtggccaacgcg
gtggccgccctgtcggagatcagcgagtcgcaccccaacagcaacctgctggacctgaac
ccccagaacatcaacaagctgctgacggccctgaacgaatgcaccgaatggggccagatc
ttcatcctggactgcctgtccaactacaacccgaaggacgaccgcgaagcccagagcatc
tgcgagcgggtgaccccccggctgtcccacgccaactcggcggtggtcctgtcggcggtg
aaggtgctgatgaagttcctggagctgctgcccaaggactcggactattacaacatgctg
ctgaagaagctggccccgccgctggtcaccctgctgtccggcgagcccgaggtccagtac
gtcgccctgcgcaacatcaacctgatcgtgcagaagagccgtccggcaaagcgggtgcgg
gccatcggccggtgcgccatcaaggtggagcaatccgccgagcgctgcgtgagcaccctg
ctggacttcatccagaccaaggtcaactacgtggtccaggaggccatcgtcgtcatccgg
gacatcttccgcaagtaccccaacaagtacgagagcatcatcgccacgctgtgcgagaac
ctcgactccctggacgagccggacgcccgggcggccatgatctggatcgtgggcgagtac
gccgagaggatcgacaacgccgacgagctgctggagagcttcctcgagggattccacgac
gagagcacccaggtccagctcactctgctgaccgccatcgtcaagctgttcctcaagaaa
ccgtcggaaacccaggagctggtccagcaggtgttgagcctggccacccaggattccgac
aatcccgacctgcgggaccggggatacatctactggcgtctcctctcgacggaccccgtg
acggccaaggaggtggtcctgtcggagaagcccctgatctcggaggagacggacctcatc
gagccgaccctgctcgacgagctcatctgtcacatcggttccctggcctccgtctaccac
aagcccccgaacgctttcgtggagggcggccacggcatccaccgcaagcacctgcccatt
caccacggaagcacggacgccggagacagccccgtgggcgccgccgcggccgcggccacc
gccgccaacctggagcagcctcaggtcatcccctcgcagggcgacctcctgggagacctc
ctgaacctggacttgggcccgcccgtcaacgtgccccaggtctcctccatgcagatgggg
gccgtcgacctcctcgggggaggcctcgacagcttggtaggacagtccttcattccgtcc
tccgtcccggcgaccttcgccccctcgcctaccccggccgtggtcagcagcggactcaac
gacctgttcgaactctccactgggatcggcatggcccccggaggattcgtggctcccaaa
gctgtctggctgcccgcggtgaaggccaagggcctggagatctcggggacgttcacccac
cggcagggccacgtctacatggacatgaacttcaccaacaaggcactgcagcacatgacc
gactttgccatccagtttaacaagaatagctttggcgtcatccccagcgcccccctggcc
attcacaccccgctgatgcccaaccagagcatcgacatctcccttcccctcaacaccctg
ggcccggtcatgaagatggagccgctgaacaacctgcaggtggccgtgaaaaataacatc
gacgtcttctacttcagctgcctcatccccctcaacgtgctctttgtcgaggacggcaag
atggagcgccaggtcttcctcgcgacctggaaggacattcccaatgaaaacgagctgcag
ttccagattaaggagtgccacctgaacgccgacgccgtgtccagcaagctgcagaacaac
aacgtgtataccatcgccaagaggaacgtggaagggcaggacatgctgtaccagtccctg
aaactcaccaacggcatctggatcctggccgagctgcggatccagccggggaaccccaac
tacacg

DBGET integrated database retrieval system