KEGG   Ornithorhynchus anatinus (platypus): 100092831Help
Entry
100092831         CDS       T01045                                 

Gene name
TPI1
Definition
(RefSeq) triosephosphate isomerase 1
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100092831 (TPI1)
   01230 Biosynthesis of amino acids
    100092831 (TPI1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100092831 (TPI1)
   00051 Fructose and mannose metabolism
    100092831 (TPI1)
   00562 Inositol phosphate metabolism
    100092831 (TPI1)
Enzymes [BR:oaa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     100092831 (TPI1)
Exosome [BR:oaa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100092831 (TPI1)
  Exosomal proteins of bladder cancer cells
   100092831 (TPI1)
  Exosomal proteins of melanoma cells
   100092831 (TPI1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 84 aa AA seqDB search
MIKDCGATWVILGHSERRHVFGESDELIGQKVAHALAEGLGVIACIGEKLDEREAGITEK
VVFEQTKVISGKKTTGLGTRTLSG
NT seq 252 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaggactgcggtgccacctgggtcatcctgggccattccgagcggagacacgtg
ttcggggagtcggatgagctgatagggcagaaggtggcccacgccctggccgaggggctg
ggcgtcatcgcctgcatcggggagaagctggacgagagggaagcgggcatcaccgagaag
gtggtctttgagcaaaccaaggtcatctcaggtaaaaagacgacgggcctggggacgcgg
accctttccgga

DBGET integrated database retrieval system