KEGG   Ornithorhynchus anatinus (platypus): 100092844Help
Entry
100092844         CDS       T01045                                 

Definition
ras-related C3 botulinum toxin substrate 2-like
Orthology
K07860  
Ras-related C3 botulinum toxin substrate 2
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Chemokine signaling pathway
Wnt signaling pathway
Axon guidance
VEGF signaling pathway
Focal adhesion
Adherens junction
Natural killer cell mediated cytotoxicity
B cell receptor signaling pathway
Fc epsilon RI signaling pathway
Fc gamma R-mediated phagocytosis
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Pathways in cancer
Colorectal cancer
Pancreatic cancer
Viral myocarditis
Class
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:oaa04014]
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:oaa04015]
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:oaa04010]
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:oaa04310]
Environmental Information Processing; Signal transduction; VEGF signaling pathway [PATH:oaa04370]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:oaa04810]
Cellular Processes; Cell communication; Focal adhesion [PATH:oaa04510]
Cellular Processes; Cell communication; Adherens junction [PATH:oaa04520]
Organismal Systems; Immune system; Natural killer cell mediated cytotoxicity [PATH:oaa04650]
Organismal Systems; Immune system; B cell receptor signaling pathway [PATH:oaa04662]
Organismal Systems; Immune system; Fc epsilon RI signaling pathway [PATH:oaa04664]
Organismal Systems; Immune system; Fc gamma R-mediated phagocytosis [PATH:oaa04666]
Organismal Systems; Immune system; Leukocyte transendothelial migration [PATH:oaa04670]
Organismal Systems; Immune system; Chemokine signaling pathway [PATH:oaa04062]
Organismal Systems; Development; Axon guidance [PATH:oaa04360]
Human Diseases; Cancers; Pathways in cancer [PATH:oaa05200]
Human Diseases; Cancers; Colorectal cancer [PATH:oaa05210]
Human Diseases; Cancers; Pancreatic cancer [PATH:oaa05212]
Human Diseases; Cardiovascular diseases; Viral myocarditis [PATH:oaa05416]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 192 aa AA seqDB search
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLR
DDKDTIEKLKEKKLAPITYPQGLALAKEIHSVKYLECSALTQRGLKTVFDEAIRAVLCPQ
PTRPQKRGCQLL
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgcaggccatcaaatgtgtcgtggtgggagatggagctgtgggaaaaacctgcctgctt
atcagctacaccaccaatgcttttcctggagagtacatccccaccgttttcgataactat
tcagccaatgtgatggtggacagcaaaccggtgaacttgggactgtgggatacagccggt
caggaggactacgatcgtctgcggcccctctcctacccccaaacggatgtcttcctgatc
tgcttctcccttgtcagtccagcttcctacgagaacgtccgagccaagtggttccccgag
gtgcggcaccattgccccagcacccccatcatcctggtgggcaccaagctggacctgcgg
gacgacaaggacaccatcgagaagctgaaggagaagaagctggcacccatcacctacccc
cagggtctcgcactagccaaggagattcactctgtgaagtacctagaatgttcagcactc
acccaacgggggctgaaaaccgtcttcgacgaggccatccgggccgtcctctgcccccag
ccaacccggccgcagaaacgcggctgccaacttctctag

DBGET integrated database retrieval system