KEGG   Ornithorhynchus anatinus (platypus): 100092844Help
Entry
100092844         CDS       T01045                                 

Gene name
RAC2
Definition
(RefSeq) ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2)
  KO
K07860  Ras-related C3 botulinum toxin substrate 2
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa04010  MAPK signaling pathway
oaa04014  Ras signaling pathway
oaa04015  Rap1 signaling pathway
oaa04024  cAMP signaling pathway
oaa04062  Chemokine signaling pathway
oaa04071  Sphingolipid signaling pathway
oaa04310  Wnt signaling pathway
oaa04360  Axon guidance
oaa04370  VEGF signaling pathway
oaa04510  Focal adhesion
oaa04520  Adherens junction
oaa04650  Natural killer cell mediated cytotoxicity
oaa04662  B cell receptor signaling pathway
oaa04664  Fc epsilon RI signaling pathway
oaa04666  Fc gamma R-mediated phagocytosis
oaa04670  Leukocyte transendothelial migration
oaa04810  Regulation of actin cytoskeleton
oaa05200  Pathways in cancer
oaa05210  Colorectal cancer
oaa05212  Pancreatic cancer
oaa05231  Choline metabolism in cancer
oaa05416  Viral myocarditis
oaa05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100092844 (RAC2)
   04015 Rap1 signaling pathway
    100092844 (RAC2)
   04010 MAPK signaling pathway
    100092844 (RAC2)
   04310 Wnt signaling pathway
    100092844 (RAC2)
   04370 VEGF signaling pathway
    100092844 (RAC2)
   04071 Sphingolipid signaling pathway
    100092844 (RAC2)
   04024 cAMP signaling pathway
    100092844 (RAC2)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    100092844 (RAC2)
   04520 Adherens junction
    100092844 (RAC2)
  Cell motility
   04810 Regulation of actin cytoskeleton
    100092844 (RAC2)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    100092844 (RAC2)
   04662 B cell receptor signaling pathway
    100092844 (RAC2)
   04664 Fc epsilon RI signaling pathway
    100092844 (RAC2)
   04666 Fc gamma R-mediated phagocytosis
    100092844 (RAC2)
   04670 Leukocyte transendothelial migration
    100092844 (RAC2)
   04062 Chemokine signaling pathway
    100092844 (RAC2)
  Development
   04360 Axon guidance
    100092844 (RAC2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100092844 (RAC2)
   05231 Choline metabolism in cancer
    100092844 (RAC2)
   05210 Colorectal cancer
    100092844 (RAC2)
   05212 Pancreatic cancer
    100092844 (RAC2)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100092844 (RAC2)
   05416 Viral myocarditis
    100092844 (RAC2)
GTP-binding proteins [BR:oaa04031]
 Small (Monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    100092844 (RAC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf
Motif
Other DBs
NCBI-GeneID: 100092844
NCBI-ProteinID: XP_001513560
UniProt: F7FH99
Position
Un
AA seq 192 aa AA seqDB search
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLR
DDKDTIEKLKEKKLAPITYPQGLALAKEIHSVKYLECSALTQRGLKTVFDEAIRAVLCPQ
PTRPQKRGCQLL
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgcaggccatcaaatgtgtcgtggtgggagatggagctgtgggaaaaacctgcctgctt
atcagctacaccaccaatgcttttcctggagagtacatccccaccgttttcgataactat
tcagccaatgtgatggtggacagcaaaccggtgaacttgggactgtgggatacagccggt
caggaggactacgatcgtctgcggcccctctcctacccccaaacggatgtcttcctgatc
tgcttctcccttgtcagtccagcttcctacgagaacgtccgagccaagtggttccccgag
gtgcggcaccattgccccagcacccccatcatcctggtgggcaccaagctggacctgcgg
gacgacaaggacaccatcgagaagctgaaggagaagaagctggcacccatcacctacccc
cagggtctcgcactagccaaggagattcactctgtgaagtacctagaatgttcagcactc
acccaacgggggctgaaaaccgtcttcgacgaggccatccgggccgtcctctgcccccag
ccaacccggccgcagaaacgcggctgccaacttctctag

DBGET integrated database retrieval system