KEGG   Ornithorhynchus anatinus (platypus): 100092844Help
Entry
100092844         CDS       T01045                                 

Gene name
RAC2
Definition
ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2)
Orthology
K07860  
Ras-related C3 botulinum toxin substrate 2
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
cAMP signaling pathway
Chemokine signaling pathway
Wnt signaling pathway
Axon guidance
VEGF signaling pathway
Focal adhesion
Adherens junction
Natural killer cell mediated cytotoxicity
B cell receptor signaling pathway
Fc epsilon RI signaling pathway
Fc gamma R-mediated phagocytosis
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Pathways in cancer
Colorectal cancer
Pancreatic cancer
Viral myocarditis
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100092844 (RAC2)
   04015 Rap1 signaling pathway
    100092844 (RAC2)
   04010 MAPK signaling pathway
    100092844 (RAC2)
   04310 Wnt signaling pathway
    100092844 (RAC2)
   04370 VEGF signaling pathway
    100092844 (RAC2)
   04024 cAMP signaling pathway
    100092844 (RAC2)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100092844 (RAC2)
  Cellular commiunity
   04510 Focal adhesion
    100092844 (RAC2)
   04520 Adherens junction
    100092844 (RAC2)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    100092844 (RAC2)
   04662 B cell receptor signaling pathway
    100092844 (RAC2)
   04664 Fc epsilon RI signaling pathway
    100092844 (RAC2)
   04666 Fc gamma R-mediated phagocytosis
    100092844 (RAC2)
   04670 Leukocyte transendothelial migration
    100092844 (RAC2)
   04062 Chemokine signaling pathway
    100092844 (RAC2)
  Development
   04360 Axon guidance
    100092844 (RAC2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100092844 (RAC2)
   05210 Colorectal cancer
    100092844 (RAC2)
   05212 Pancreatic cancer
    100092844 (RAC2)
  Cardiovascular diseases
   05416 Viral myocarditis
    100092844 (RAC2)
GTP-binding proteins [BR:oaa04031]
 Small (Monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    100092844 (RAC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 192 aa AA seqDB search
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLR
DDKDTIEKLKEKKLAPITYPQGLALAKEIHSVKYLECSALTQRGLKTVFDEAIRAVLCPQ
PTRPQKRGCQLL
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgcaggccatcaaatgtgtcgtggtgggagatggagctgtgggaaaaacctgcctgctt
atcagctacaccaccaatgcttttcctggagagtacatccccaccgttttcgataactat
tcagccaatgtgatggtggacagcaaaccggtgaacttgggactgtgggatacagccggt
caggaggactacgatcgtctgcggcccctctcctacccccaaacggatgtcttcctgatc
tgcttctcccttgtcagtccagcttcctacgagaacgtccgagccaagtggttccccgag
gtgcggcaccattgccccagcacccccatcatcctggtgggcaccaagctggacctgcgg
gacgacaaggacaccatcgagaagctgaaggagaagaagctggcacccatcacctacccc
cagggtctcgcactagccaaggagattcactctgtgaagtacctagaatgttcagcactc
acccaacgggggctgaaaaccgtcttcgacgaggccatccgggccgtcctctgcccccag
ccaacccggccgcagaaacgcggctgccaacttctctag

DBGET integrated database retrieval system