KEGG   Ornithorhynchus anatinus (platypus): 100092899Help
Entry
100092899         CDS       T01045                                 

Definition
serine/threonine-protein kinase 6-like
Orthology
K11481  
aurora kinase A [EC:2.7.11.1]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Oocyte meiosis
Class
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:oaa04114]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 286 aa AA seqDB search
MKNPKSKRQWSLDDFDIGRPLGKGKFGNVYLAREKQSKFILALKVLFKGQLEKAGVEHQL
RREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAPRGEVYRELQKFSKFDEQRTATYIT
ELADALSYCHSKKVIHRDIKPENLLLGSDGELKIADFGWSVHAPSSRRTTLCGTLDYLPP
EMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEAETYQETYRSISKVEYKFPGFVTDGAKD
LISKLLKHNPYQRLTLKEVLEHPWITANSSKAPNSLKSQESTSTKS
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatccaaaaagtaaacggcagtggtcattggatgactttgatatcggtcgccct
ctgggaaaagggaaatttggaaatgtttacttggccagggagaaacaaagcaaatttatc
ctggcattgaaggtgctatttaaaggccaactggagaaagcaggagtcgaacatcagctg
cgacgagaagtcgaaatccagtctcatcttaggcatccaaatattctcagattatatggg
tatttccacgatgccacccgggtttacttgattctagaatatgcacctcgtggagaagta
tacagagaacttcagaaattttctaagtttgatgaacagagaactgctacttatatcacg
gagttggctgatgccctatcgtactgccactcgaaaaaagtgattcaccgagatattaag
cctgaaaatctgttgcttggatcagatggtgaactgaagattgctgactttggatggtct
gtgcacgccccctcatctaggaggacaactctgtgtggcactcttgactacttgcctcct
gagatgattgaaggacgaatgcatgatgagaaggtggatctctggagtcttggagtcctg
tgttatgaatttttagtgggcaaacctccctttgaggcagaaacctaccaagaaacttac
aggagcatttcaaaggttgaatataaatttcctggcttcgtaacggatggagctaaggat
cttatctcaaaactcctgaagcataacccataccagaggctaactttaaaggaagtgctc
gaacacccgtggatcacagcaaactcgtcgaaagcaccgaacagcctaaagagccaagag
tccaccagcacgaaatcctag

DBGET integrated database retrieval system