KEGG   Ornithorhynchus anatinus (platypus): 100092899Help
Entry
100092899         CDS       T01045                                 

Definition
(RefSeq) aurora kinase A-like
  KO
K11481  
aurora kinase A [EC:2.7.11.1]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Oocyte meiosis
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    100092899
Enzymes [BR:oaa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100092899
Protein kinases [BR:oaa01001]
 Serine/threonine protein kinases: Other group
  Aur family [OT]
   100092899
Protein phosphatases and associated proteins [BR:oaa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100092899
Chromosome [BR:oaa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100092899
  Spindle formation proteins
   100092899
  Sister chromatid separation proteins
   Aurora kinases
    100092899
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 303 aa AA seqDB search
NIPEKREVPSQKEAPCQKNEESKKRQWSLDDFDIGRPLGKGKFGNVYLAREKQSKFILAL
KVLFKGQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAPRGEVYRE
LQKFSKFDEQRTATYITELADALSYCHSKKVIHRDIKPENLLLGSDGELKIADFGWSVHA
PSSRRTTLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEAETYQETYRSI
SKVEYKFPGFVTDGAKDLISKLLKHNPYQRLTLKEVLEHPWITANSSKAPNSLKSQESTS
TKS
NT seq 914 nt NT seq  +upstreamnt  +downstreamnt
caaacattcctgaaaagagagaagtacctagccagaaagaggcaccttgccagaagaatg
aagaatccaaaaaacggcagtggtcattggatgactttgatatcggtcgccctctgggaa
aagggaaatttggaaatgtttacttggccagggagaaacaaagcaaatttatcctggcat
tgaaggtgctatttaaaggccaactggagaaagcaggagtcgaacatcagctgcgacgag
aagtcgaaatccagtctcatcttaggcatccaaatattctcagattatatgggtatttcc
acgatgccacccgggtttacttgattctagaatatgcacctcgtggagaagtatacagag
aacttcagaaattttctaagtttgatgaacagagaactgctacttatatcacggagttgg
ctgatgccctatcgtactgccactcgaaaaaagtgattcaccgagatattaagcctgaaa
atctgttgcttggatcagatggtgaactgaagattgctgactttggatggtctgtgcacg
ccccctcatctaggaggacaactctgtgtggcactcttgactacttgcctcctgagatga
ttgaaggacgaatgcatgatgagaaggtggatctctggagtcttggagtcctgtgttatg
aatttttagtgggcaaacctccctttgaggcagaaacctaccaagaaacttacaggagca
tttcaaaggttgaatataaatttcctggcttcgtaacggatggagctaaggatcttatct
caaaactcctgaagcataacccataccagaggctaactttaaaggaagtgctcgaacacc
cgtggatcacagcaaactcgtcgaaagcaccgaacagcctaaagagccaagagtccacca
gcacgaaatcctag

DBGET integrated database retrieval system