KEGG   Ornithorhynchus anatinus (platypus): 100092899Help
Entry
100092899         CDS       T01045                                 

Definition
aurora kinase A-like
Orthology
K11481  
aurora kinase A [EC:2.7.11.1]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Oocyte meiosis
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    100092899
Enzymes [BR:oaa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100092899
Protein kinases [BR:oaa01001]
 Serine/threonine protein kinases: Other group
  Aur family [OT]
   100092899
Protein phosphatases and associated proteins [BR:oaa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100092899
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 303 aa AA seqDB search
NIPEKREVPSQKEAPCQKNEESKKRQWSLDDFDIGRPLGKGKFGNVYLAREKQSKFILAL
KVLFKGQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAPRGEVYRE
LQKFSKFDEQRTATYITELADALSYCHSKKVIHRDIKPENLLLGSDGELKIADFGWSVHA
PSSRRTTLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEAETYQETYRSI
SKVEYKFPGFVTDGAKDLISKLLKHNPYQRLTLKEVLEHPWITANSSKAPNSLKSQESTS
TKS
NT seq 914 nt NT seq  +upstreamnt  +downstreamnt
caaacattcctgaaaagagagaagtacctagccagaaagaggcaccttgccagaagaatg
aagaatccaaaaaacggcagtggtcattggatgactttgatatcggtcgccctctgggaa
aagggaaatttggaaatgtttacttggccagggagaaacaaagcaaatttatcctggcat
tgaaggtgctatttaaaggccaactggagaaagcaggagtcgaacatcagctgcgacgag
aagtcgaaatccagtctcatcttaggcatccaaatattctcagattatatgggtatttcc
acgatgccacccgggtttacttgattctagaatatgcacctcgtggagaagtatacagag
aacttcagaaattttctaagtttgatgaacagagaactgctacttatatcacggagttgg
ctgatgccctatcgtactgccactcgaaaaaagtgattcaccgagatattaagcctgaaa
atctgttgcttggatcagatggtgaactgaagattgctgactttggatggtctgtgcacg
ccccctcatctaggaggacaactctgtgtggcactcttgactacttgcctcctgagatga
ttgaaggacgaatgcatgatgagaaggtggatctctggagtcttggagtcctgtgttatg
aatttttagtgggcaaacctccctttgaggcagaaacctaccaagaaacttacaggagca
tttcaaaggttgaatataaatttcctggcttcgtaacggatggagctaaggatcttatct
caaaactcctgaagcataacccataccagaggctaactttaaaggaagtgctcgaacacc
cgtggatcacagcaaactcgtcgaaagcaccgaacagcctaaagagccaagagtccacca
gcacgaaatcctag

DBGET integrated database retrieval system