KEGG   Ornithorhynchus anatinus (platypus): 100092985Help
Entry
100092985         CDS       T01045                                 

Gene name
GPLD1
Definition
glycosylphosphatidylinositol specific phospholipase D1
Orthology
K01127  
glycosylphosphatidylinositol phospholipase D [EC:3.1.4.50]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Glycosylphosphatidylinositol(GPI)-anchor biosynthesis [PATH:oaa00563]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 666 aa AA seqDB search
MSASRNWSVLLAIGLCHLCPPCLPCGISTHIEIAHRALEFFHLESGRVNYRELLLKHQDA
YQAGSVYPDSFYPQFCKLGKFHEVSEDTHWAPFLNASVRYVRENFPLPWEQDTEKLVAFL
FGISSHMVADVSWHGLGIEQGFLRTMGAIDFHGSYSEAHRAGDFGGDVLSQFEFNFNYLS
RGWYVPVRDLVGIYEELYGREEVITQDVIADCTYLQFLELFGEILAVSKLYPTFARKSPF
MVDQFQEYFLGGLDDMAFWSNNIFHLMGRMLENGTRDCTVPENPLFITCGRKPGGSLGEK
MSQPQLRKNTTVPIGTNVERNVNFTERGAYFSVDTWAPNSVSSMYSLLAKKMQTVFSGAN
RESPNHVSSPIASYFVGVPYARLGWAVTSADLNEDGHDDLVVGAPGYSRPGRVQLGRVYV
VYANGLGLPPADTDLDEEAHAILEGSQPSGRFGSAVAVMDWNLDGVPDLAVGAPSVGSDG
LSYTGAVYVFFGTRGKGVSPRPNVTVSCRDKYCNFGWTLLAADVDGDGAADLVVGSPYAP
QGGRQRGLVAAFYSRCSRSGKDENCSSSLGSQFYNREEKQSVGKVNGYLPPSRQSWFAIS
RNQAMGKLGSSLSSGQLAVDGTPRQVLLIGASTRDDVSKMAFVPTTLHQGGSTRLYGLSA
GEAPAL
NT seq 1997 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcttctaggaactggtccgtcctgctggcgatagggctctgccacctgtgtcca
ccgtgtctgccctgtggaatttcgacacatatcgaaatagctcacagggccctggagttc
ttccacctggagagcgggagagtgaactaccgagagctcttgctgaaacatcaggatgcg
tatcaggctgggagcgtctatcctgactccttttaccctcagttctgcaagctaggaaaa
ttccacgaagtgtccgaagacacccactgggctccgtttctcaacgccagcgtccgctac
gtccgcgaaaacttccctcttccctgggagcaggatacagagaagctggtggctttcctg
tttggcatttcctcccatatggtggcagatgtgagctggcacggcctcggcattgagcag
ggattcttgaggaccatgggagccattgattttcacggctcttacagtgaagctcatcga
gccggagattttggaggagatgtgctgagccagttcgagtttaattttaattacctctcc
cggggctggtacgtgcccgtcagagatctggtagggatctacgaggagctctacggacga
gaggaggtcattacccaagacgtaattgccgactgcacctatcttcagttcttggagttg
ttcggagagatactggccgtgtccaagctttacccaaccttcgccagaaaatccccgttc
atggtggaccagtttcaggagtattttctgggcggattggatgacatggcattttggtcc
aacaacattttccatctaatgggccgtatgttggagaatgggaccagggattgcactgtc
cccgaaaaccctctgttcataacctgtggaaggaagcccggaggctctcttggggagaag
atgagccagccccagctccgcaagaacacgaccgtccccatcggcaccaacgtcgagagg
aacgtaaacttcaccgaacgaggagcctatttcagcgtggacacctgggccccgaattcc
gtctcctccatgtactctctcctggcgaagaagatgcaaacggtgttttccggcgccaac
cgggagtcgcccaaccacgtctccagccccatcgcctcctacttcgtgggtgtgccctac
gccaggctcggctgggccgtgacctcggctgacctgaacgaggacgggcacgacgacctg
gtggtgggagccccgggctacagccggccggggcgcgtccagctcggccgggtgtacgtc
gtgtacgcgaacgggctcggcctgcctccggcggacacggacctggacgaggaagcccac
gccatcctggagggctcccagccctcgggtcgcttcggctcggcggtcgccgtgatggac
tggaatctggacggagtcccagacttggcggtgggggccccctcggtgggctccgacggg
ctcagctacacgggtgccgtgtacgtgttcttcgggaccagagggaaaggcgtgtctcct
cgccccaacgtcaccgtctcctgccgggacaagtactgcaatttcggctggacgcttctg
gcggcggacgtggacggggatggggccgcggatctggtggtcggttcgccctacgccccc
cagggagggaggcagcgggggctcgtggccgcgttttactctcgctgcagcaggtccggc
aaagatgagaattgctcgtccagcctaggctcgcagttctacaaccgggaggagaaacag
agcgtgggcaaggtgaatggctatttgccaccgagtcggcaaagctggtttgcgatatct
cgtaaccaggcgatggggaaactgggctcatcgctgtcgagcggccagctggctgtggac
gggaccccgaggcaggtgctgctcatcggtgcctcgacccgggatgacgtgtccaaaatg
gcgttcgtgcccacgaccctgcaccaggggggcagcacgcggctgtacgggctgtccgcc
ggggaggcgcccgccct

DBGET integrated database retrieval system