KEGG   Ornithorhynchus anatinus (platypus): 100092985Help
Entry
100092985         CDS       T01045                                 

Gene name
GPLD1
Definition
phosphatidylinositol-glycan-specific phospholipase D
Orthology
K01127  
glycosylphosphatidylinositol phospholipase D [EC:3.1.4.50]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
    100092985 (GPLD1)
Enzymes [BR:oaa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.50  glycosylphosphatidylinositol phospholipase D
     100092985 (GPLD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 632 aa AA seqDB search
MAGMRLRLLPGSWSRNWSVLLAIGLCHLCPPCLPCGISTHIEIAHRALEFFHLESGRVNY
RELLLKHQDAYQAGSVYPDSFYPQFCKLGKFHEVSEDTHWAPFLNASVRYVRENFPLPWE
QDTEKLVAFLFGISSHMVADVSWHGLGIEQGFLRTMGAIDFHGSYSEAHRAGDFGGDVLS
QFEFNFNYLSRGWYVPVRDLVGIYEELYGREEVITQDVIADCTYLQFLELFGEILAVSKL
YPTFARKSPFMVDQFQEYFLGGLDDMAFWSNNIFHLMGRMLENGTRDCTVPENPLFITCG
RKPGGSLGEKMSQPQLRKNTTVPIGTNVERNVNFTERGAYFSVDTWAPNSVSSMYSLLAK
KMQTVFSGANRESPNHVSSPIASYFVGVPYARLGWAVTSADLNEDGHDDLVVGAPGYSRP
GRVQLGRVYVVYANGLGLPPADTDLDEEAHAILEGSQPSGRFGSAVAVMDWNLDGVPDLA
VGAPSVGSDGLSYTGAVYVFFGTRGKGVSPRPNVTVSCRDKYCNFGWTLLAADVDGDGAA
DLVVGSPYAPQGGRQRGLVAAFYSRCSRSGKGDVRGGGGLDSVTRRPRGSLPWPCCRVEA
GRKSRCEPQFAPDLLGGENGSKNKSAEKPRGR
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atggccgggatgcggctccgtctcctccccggctcctggtccaggaactggtccgtcctg
ctggcgatagggctctgccacctgtgtccaccgtgtctgccctgtggaatttcgacacat
atcgaaatagctcacagggccctggagttcttccacctggagagcgggagagtgaactac
cgagagctcttgctgaaacatcaggatgcgtatcaggctgggagcgtctatcctgactcc
ttttaccctcagttctgcaagctaggaaaattccacgaagtgtccgaagacacccactgg
gctccgtttctcaacgccagcgtccgctacgtccgcgaaaacttccctcttccctgggag
caggatacagagaagctggtggctttcctgtttggcatttcctcccatatggtggcagat
gtgagctggcacggcctcggcattgagcagggattcttgaggaccatgggagccattgat
tttcacggctcttacagtgaagctcatcgagccggagattttggaggagatgtgctgagc
cagttcgagtttaattttaattacctctcccggggctggtacgtgcccgtcagagatctg
gtagggatctacgaggagctctacggacgagaggaggtcattacccaagacgtaattgcc
gactgcacctatcttcagttcttggagttgttcggagagatactggccgtgtccaagctt
tacccaaccttcgccagaaaatccccgttcatggtggaccagtttcaggagtattttctg
ggcggattggatgacatggcattttggtccaacaacattttccatctaatgggccgtatg
ttggagaatgggaccagggattgcactgtccccgaaaaccctctgttcataacctgtgga
aggaagcccggaggctctcttggggagaagatgagccagccccagctccgcaagaacacg
accgtccccatcggcaccaacgtcgagaggaacgtaaacttcaccgaacgaggagcctat
ttcagcgtggacacctgggccccgaattccgtctcctccatgtactctctcctggcgaag
aagatgcaaacggtgttttccggcgccaaccgggagtcgcccaaccacgtctccagcccc
atcgcctcctacttcgtgggtgtgccctacgccaggctcggctgggccgtgacctcggct
gacctgaacgaggacgggcacgacgacctggtggtgggagccccgggctacagccggccg
gggcgcgtccagctcggccgggtgtacgtcgtgtacgcgaacgggctcggcctgcctccg
gcggacacggacctggacgaggaagcccacgccatcctggagggctcccagccctcgggt
cgcttcggctcggcggtcgccgtgatggactggaatctggacggagtcccagacttggcg
gtgggggccccctcggtgggctccgacgggctcagctacacgggtgccgtgtacgtgttc
ttcgggaccagagggaaaggcgtgtctcctcgccccaacgtcaccgtctcctgccgggac
aagtactgcaatttcggctggacgcttctggcggcggacgtggacggggatggggccgcg
gatctggtggtcggttcgccctacgccccccagggagggaggcagcgggggctcgtggcc
gcgttttactctcgctgcagcaggtccggcaaaggtgacgtccggggcggggggggtctc
gattctgttacgcggcggccgcgagggtctctgccctggccctgctgccgcgtggaagcg
gggagaaagtcccggtgcgagccacagttcgccccagacttgctggggggtgaaaacgga
tccaaaaacaaaagcgcagagaagccacgtggccgatag

DBGET integrated database retrieval system