KEGG   Ornithorhynchus anatinus (platypus): 100092988Help
Entry
100092988         CDS       T01045                                 

Gene name
THBS1
Definition
thrombospondin 1
Orthology
K16857  
thrombospondin 1
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Rap1 signaling pathway
p53 signaling pathway
Phagosome
PI3K-Akt signaling pathway
TGF-beta signaling pathway
Focal adhesion
ECM-receptor interaction
Malaria
Proteoglycans in cancer
MicroRNAs in cancer
Bladder cancer
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    100092988 (THBS1)
   04350 TGF-beta signaling pathway
    100092988 (THBS1)
   04151 PI3K-Akt signaling pathway
    100092988 (THBS1)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100092988 (THBS1)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    100092988 (THBS1)
  Cell growth and death
   04115 p53 signaling pathway
    100092988 (THBS1)
  Cell communication
   04510 Focal adhesion
    100092988 (THBS1)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    100092988 (THBS1)
   05205 Proteoglycans in cancer
    100092988 (THBS1)
   05219 Bladder cancer
    100092988 (THBS1)
  Infectious diseases
   05144 Malaria
    100092988 (THBS1)
Heparan sulfate/heparin binding proteins [BR:oaa00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  100092988 (THBS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1032 aa AA seqDB search
MPAPPGAVGANAPRARAGDVCQPPGAGGTHPPGAGLTLQPAGTRTPATEPKLGAPTDLSG
RTSGLGGAGCARASWAAGLEFGCPGVGVLKPPLTVRLPAATSAVITLDNPVNGSSPAIRT
DFIGHKTKDTQGVCGFSCDELTGMFMELKGLRTIVTGLQDSIRKVTEENELLINGEVQRP
PICFHNGVQYRNNEEWTIDSCTECRCQNSVTICKKVSCPLMPCSNATIPDGECCPRCWPS
DSAEDSWSPWSVWITCSASLPARVSFSHSHKRWECHQSCHKKKSVRLRGASRPVNQDGGW
SHWSPWSSCSVTCGDGVITRIRLCNSPSPQMNGKPCKGEARETKACQKDACPINGGWGPW
SPWDVCSATCGGGLQQRKRLCNNPKPQFGGKDCVGDATGSQTCNKQDCPIDGCLSNPCFA
GTKCTSFADGTWKCGACPSGYTGDGVRCKDIDECLEVPDACFHFNGEHRCENTDPGYNCL
PCPPRFAGPRPFGRSIEFAAANKQVCKPRNPCTDGTHDCNRNAKCNYLGHFSDPMFRCEC
KPGYAGNGIICGEDTDLDGWPNEDLVCVANATYHCKKDNCPNIPNSGQEDYDGDGIGDAC
DSDDDNDKIPDDRDNCPFHYNPAQYDYDRDDVGDRCDNCPYSPNPDQADTDNNGEGDACA
VDIDGDGIRNERDNCQYVYNVDQKDSDMDGVGDHCDNCPMEHNPDQLDSDSDRIGDKCDN
NQDIDEDGHQNNLDNCPYVPNANQADHDKDGKGDACDHDDDNDGVPDDKDNCRLVPNPDQ
KDSDGDGRGDACKDDFDHDNVPDIDDICPENVDISETDFRRFQMIPLDPKGTSQNDPNWV
VRHQGKELVQTVNCDPGLAVGFDEFNAVDFSGTFFINTERDDDYAGFVFGYQSSSRFYVV
MWKQVTQSYWDSTPTIAQGYSGLSVKVVNSTTGPGEHLRNALWHTGNTTGQVRTLWHDPR
HIGWKDFTAYRWRLSHRPKTGYIRVVMYEGKKIMADSGAIYDKTYAGGRLGLFVFSQEMV
FFSDLKYECKDS
NT seq 3099 nt NT seq  +upstreamnt  +downstreamnt
atgccagcgccccccggagccgtcggcgccaacgccccccgggctagagccggagacgtc
tgccagccacccggggcaggaggcacccacccgcctggtgctggcctgaccctccagccc
gcgggcacaagaaccccagcaacggagccgaagttgggagcgcccactgacctgagcggc
cgaacctcgggactcggtggtgccggctgcgccagagcctcctgggcagcggggctggag
tttgggtgcccgggtgtgggcgtcctcaaacctcccctgactgtccggctccccgcagcc
accagcgcggtcatcaccctcgacaaccccgtgaacggctccagcccggccatccgcacc
gatttcatcggccacaagaccaaggacacgcagggtgtctgcggcttctcctgcgacgag
ctgaccggcatgttcatggagctaaaggggctgcgcaccatcgtgaccggtctgcaggac
agcatccgcaaagtgacggaagagaacgaactgttgatcaacggggaggtgcagaggcct
cccatctgcttccacaacggcgtccagtacaggaacaacgaggagtggaccatcgacagt
tgcaccgagtgccgttgccagaactccgtcaccatatgcaagaaagtctcctgcccgctc
atgccctgctccaacgccacgattcccgacggcgaatgctgcccgcggtgctggcccagc
gactcggcagaggacagctggtccccctggtccgtatggatcacctgctcggcctcctta
cccgcacgtgtctctttctcccactcccacaagagatgggagtgtcaccagagctgccat
aaaaagaagtctgtccggctccggggagcgagcagacccgtcaaccaggacggtggctgg
agccactggtctccctggtcgtcctgttccgtgacgtgcggcgacggggtgatcaccagg
atccgtctctgcaactcgcccagcccccagatgaacggcaagccgtgcaagggcgaggcg
cgggagaccaaggcctgccagaaggacgcctgccccatcaacggcggctgggggccctgg
tcgccgtgggatgtgtgttccgccacctgcgggggaggcctgcagcagcgcaagaggctc
tgcaacaaccccaagccccagttcggcggcaaggattgcgtcggcgatgccaccggaagc
cagacctgcaacaagcaggactgcccgatcgacggatgcctgtcgaacccctgctttgcc
ggcaccaagtgcaccagtttcgccgacggcacctggaagtgcggcgcctgcccgtctggc
tacaccggcgacggcgtccggtgcaaggatatcgacgagtgcttagaggtgcccgacgcc
tgcttccacttcaacggcgagcatcgctgcgagaacacggaccccggctacaactgcctg
ccctgcccgcctcgcttcgcgggaccgcggcccttcggtcgcagcatcgagttcgccgcc
gccaacaagcaggtgtgcaaaccccgaaacccgtgcacggacgggacccacgactgcaac
aggaacgccaagtgcaactacctgggccacttcagcgaccccatgttccgctgcgagtgc
aagccgggctacgccggcaacggcatcatctgcggggaggacacggacctggacggctgg
cccaacgaggacctcgtctgcgtggccaacgccacgtaccactgcaagaaggataactgc
cccaacatccccaactccggccaggaggactacgatggggacgggatcggagacgcgtgc
gacagtgacgatgacaacgacaagatcccggatgatcgggacaactgccccttccactac
aacccggcccagtacgactacgaccgcgacgacgtgggtgaccgctgcgacaactgcccc
tacagccccaacccggaccaggccgacaccgacaacaacggcgaaggggacgcctgtgcc
gtggacatcgacggggacggcatccgcaacgagagggacaactgtcagtacgtgtacaac
gtggaccagaaggactctgacatggatggggtcggagatcactgcgacaactgcccgatg
gagcacaatcccgaccagctggactccgattcagaccgcattggcgacaaatgcgacaac
aatcaggacatcgacgaggacggccaccagaacaacctggacaactgtccctacgtgccc
aatgccaaccaggcggatcacgacaaggacggcaagggggatgcctgcgaccacgacgat
gacaatgacggcgtgcccgacgacaaggacaactgtcggctggtgcccaatcctgaccag
aaggactcggacggcgacggccgtggcgatgcctgcaaagacgacttcgaccacgacaac
gtgcctgatatcgatgacatctgtcccgagaacgtggacatcagcgagaccgacttccgc
cgattccagatgatccctctcgaccccaagggcacatcccagaacgaccccaactgggtg
gtgcgtcaccagggcaaggagctggtccagaccgtcaactgcgatcccggcctggccgtg
ggtttcgacgagttcaacgccgtggacttcagtggcacgttcttcatcaacaccgagagg
gatgatgactacgccggcttcgtctttggttaccagtccagcagccgcttctatgtggtc
atgtggaagcaggtgacccagtcctactgggacagcacccccaccatcgcccagggatac
tccggcctctcggtcaaggtggtcaactccaccaccgggcccggcgagcacttgcggaac
gccctgtggcacaccgggaacacaaccggacaggtgcgaaccctgtggcacgacccccgc
cacattggctggaaggatttcactgcctacagatggcgtctcagccaccgccccaagacc
ggctatatcagggtggtcatgtacgagggcaagaagatcatggctgactccggggccatc
tacgacaagacctacgccgggggccgtctggggctgttcgtcttctcccaagaaatggtc
ttcttctccgacctcaaatacgagtgcaaagactcctaa

DBGET integrated database retrieval system