KEGG   Ornithorhynchus anatinus (platypus): 100092993Help
Entry
100092993         CDS       T01045                                 

Definition
uncharacterized LOC100092993
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:oaa00270]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 399 aa AA seqDB search
MVVSPSLCVNRLGKFCIKISIIVFLRGCLSATMDRAGVDTRLGVLQKGAHGLNPPTTVRP
PPRPPQIRTFYEEHLHLDDEIRYVLDGSGYFDVRDREDRWIRIAVEKGDMITLPAGIYHR
FAPDERVNPGGPRRTPRAPVSLSPSRLPPSRGAEGWRGGGRAPEGSGGGDERNKSEMPAR
GLRVFGPRAGPEGDGPDRAQVAARFSNPLPPAFILAPFGVVDDFFIPDGDRGSDPRSADE
ETEARPPRSTLSSPSEPPSCRCELSSYRDRILANGRPRSAPVLIAASPETPGRELGAVSS
LEAGDPPLAAGRPERGDFCEESVGFSKVVLPQVEKRPATPGRRPTVTGENSGRPHPIARS
CGVSLKETFKDSGIWDACSSKGRFEHSRSGDLLLLRSAQ
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggtcgtgtcaccaagcctttgtgttaatcggttgggaaagttctgtattaagatatca
atcatcgtgtttctgagggggtgtctaagtgccactatggatagagctggggtcgataca
aggttaggagttctccaaaagggggctcacggtcttaatcccccgaccaccgtccgtccg
cccccccgcccgccccagatcaggacgttttacgaagaacacctgcacctggacgacgaa
atccgctacgtcctggacggcagcggctacttcgacgtgcgggaccgggaagaccgctgg
atccggatcgccgtggagaagggcgacatgatcacgctgcccgccgggatctaccatcgc
ttcgccccggatgagagggtaaaccccgggggcccccgccggaccccgcgcgctcccgtc
tccctctccccctctcgtctacctccttcccgaggggccgaggggtggcggggggggggc
cgggctcccgagggctcgggtggaggagacgaaagaaataaaagcgagatgccggcgcgg
ggtttgcgtgtctttgggccgcgggcggggccggagggcgacggtccggatcgcgcgcaa
gtggccgctcgtttctccaaccccctccccccggcatttatactcgcgcccttcggtgtc
gtcgatgacttctttattcctgacggggatcggggatcggatccccgttctgcagatgag
gaaacggaagcgaggccgccgagatccaccctttcctccccatccgaaccgccgtcgtgc
cggtgcgagctctcgtcatatcgcgaccggatcctcgcaaacggccgtccccgttcggct
cccgtcctcatcgctgcgtctcccgagacgcccggccgagagctcggggccgtgtcttcc
ctcgaggctggtgaccctccgctagcggccggtcggccggaaagaggagatttctgtgaa
gaatctgtgggcttctccaaagttgttctgccccaggtggagaaacgccctgcaacgccc
gggagacgtccgaccgttaccggggagaattccggcaggccgcatcccatcgcccgttct
tgtggcgtttccttaaaggaaacttttaaggattccggcatttgggacgcctgctcctca
aagggtcgtttcgagcactccaggagcggggaccttttgcttctacgttcggcccagtaa

DBGET integrated database retrieval system